{"id":69022,"date":"2026-03-13T12:06:16","date_gmt":"2026-03-13T12:06:16","guid":{"rendered":"https:\/\/medsbase.com\/?post_type=product&#038;p=69022"},"modified":"2026-05-21T07:14:11","modified_gmt":"2026-05-21T07:14:11","slug":"igf-1-lr3","status":"publish","type":"product","link":"https:\/\/medsbase.com\/da\/igf-1-lr3\/","title":{"rendered":"IGF-1 LR3"},"content":{"rendered":"<p><!-- medsbase-tldr-answer --><\/p>\n<div style=\"background: #fff8e1; border-left: 4px solid #f5a623; padding: 18px 22px; margin: 18px 0; border-radius: 4px;\">\n<h3 style=\"margin: 0 0 8px 0; font-size: 16px; color: #1a4a6b;\">Quick Answer \u2014 What is IGF-1 LR3?<\/h3>\n<p style=\"margin: 0;\"><strong>IGF-1 LR3<\/strong> er et forskningspeptid leveret som et lyofiliseret pulver til rekonstitution. Det s\u00e6lges udelukkende til laboratorie- og forskningsform\u00e5l og er <strong>ikke godkendt til terapeutisk brug hos mennesker<\/strong> af FDA, EMA, MHRA eller andre store l\u00e6gemiddelmyndigheder. Oplysningerne p\u00e5 denne side beskriver offentliggjort pr\u00e6klinisk og tidlig klinisk litteratur; det er ikke medicinsk r\u00e5dgivning eller doseringsvejledning. L\u00e6s vores tilknyttede forskningsguide for den komplette evidensoversigt.<\/p>\n<\/div>\n<h2 data-section-id=\"1v2vk1x\">IGF-1 LR3 Peptide<\/h2>\n<p><span style=\"font-size: 120%;\">IGF-1 LR3 (Insulin-Like Growth Factor-1 Long R3) is a modified analog of insulin-like growth factor-1 designed for research involving cellular growth signaling, anabolic pathways, and metabolic regulation. This extended variant contains structural modifications that increase its stability and prolong its biological activity compared to standard IGF-1, allowing researchers to study sustained IGF-1 receptor activation in laboratory models. IGF-1 LR3 interacts with IGF-1 receptors involved in cellular proliferation, protein synthesis, and nutrient utilization. Due to its extended half-life and reduced binding to IGF-binding proteins, it provides a useful framework for examining mechanisms related to tissue growth, metabolic efficiency, and cellular repair processes. Research studies suggest IGF-1 LR3 may support pathways associated with muscle cell growth, enhanced protein synthesis, improved recovery from physical stress, and regulation of glucose metabolism. Its activity also makes it valuable for investigating regenerative signaling, cellular differentiation, and anabolic responses in controlled experimental environments.<\/span><\/p>\n<hr \/>\n<h2 data-section-id=\"1bovg99\"><strong>Produktoverblik<\/strong><\/h2>\n<p>IGF-1 LR3 is a synthetic research peptide classified as a modified insulin-like growth factor analog engineered to extend biological stability and receptor interaction duration in laboratory models. With the molecular formula C400H625N111O115S9 and molar mass of 9117.60 g\/mol, IGF-1 LR3 peptide is widely studied in experimental research settings focusing on cellular growth pathways and metabolic signaling. Each vial contains 0.1 mg or 1 mg of lyophilized IGF-1 LR3 supplied in high purity lyophilized form designed for laboratory investigation. The peptide is valued for its structural modifications that reduce binding to IGF-binding proteins and prolong receptor activity in controlled research environments. Image alt-text example: \u201clyophilized IGF-1 LR3 peptide vial for laboratory research investigation.\u201d IGF-1 LR3 for research maintains stability under proper storage conditions with a shelf life of approximately 36 months and is intended strictly for research and laboratory use only.<\/p>\n<hr \/>\n<h2 data-section-id=\"engqt1\"><strong>Forskningsapplikationer<\/strong><\/h2>\n<p>IGF-1 LR3 peptide is commonly utilized in laboratory investigation of cellular growth signaling and anabolic pathway activity. In vitro studies frequently examine IGF-1 receptor activation and downstream intracellular signaling mechanisms associated with protein synthesis and nutrient utilization. Pre-clinical models use IGF-1 LR3 for research to analyze cellular proliferation patterns and metabolic regulation responses. Researchers also explore tissue culture environments where growth factor signaling can be measured under controlled experimental conditions. IGF-1 LR3 supports investigations into cellular differentiation, metabolic signaling cascades, and anabolic response pathways. These applications provide valuable insight into mechanisms associated with growth signaling networks in experimental research settings.<\/p>\n<hr \/>\n<h2 data-section-id=\"g6iwef\"><strong>Rekonstitution og h\u00e5ndtering<\/strong><\/h2>\n<p>Lyophilized IGF-1 LR3 should be reconstituted using bacteriostatic water in a sterile laboratory environment. Researchers should apply strict aseptic technique when introducing solvent into the vial to preserve peptide integrity and experimental accuracy. Inject the solution slowly along the inner vial wall to prevent peptide destabilization. Avoid shaking the vial; instead, gently swirl until the lyophilized IGF-1 LR3 powder is fully dissolved. After reconstitution, store the solution at 2\u20138\u00b0C and maintain it in a controlled laboratory environment. Proper handling procedures help preserve the stability of IGF-1 LR3 peptide for consistent experimental outcomes.<\/p>\n<hr \/>\n<h2 data-section-id=\"evp82x\"><strong>Virkningsmekanisme<\/strong><\/h2>\n<p>IGF-1 LR3 peptide interacts primarily with insulin-like growth factor receptors involved in cellular growth and metabolic signaling. In experimental research settings, this interaction stimulates intracellular pathways related to protein synthesis, nutrient uptake, and cellular proliferation markers. The structural modification of IGF-1 LR3 reduces affinity for IGF-binding proteins, allowing sustained receptor activation in laboratory models. In vitro studies indicate that this prolonged signaling may influence pathways related to anabolic cellular responses. Researchers use IGF-1 LR3 for research to explore receptor activation dynamics and downstream molecular cascades. These mechanisms provide insight into regulatory processes associated with cellular growth and metabolic adaptation.<\/p>\n<hr \/>\n<h2 data-section-id=\"1dcajhc\"><strong>Unders\u00f8gelse af doseringsretningslinjer<\/strong><\/h2>\n<p>For research reference only \u2013 not for human use. Research dosing ranges reported in published experimental literature vary depending on the model system and assay design. In vitro investigations often use IGF-1 LR3 peptide concentrations measured in nanomolar to micromolar ranges depending on cell line sensitivity. Pre-clinical experimental models may adjust concentration parameters to evaluate receptor signaling responses and metabolic activity markers. Researchers should determine optimal concentration ranges through preliminary assay validation. Lyophilized IGF-1 LR3 should be prepared and measured carefully to maintain experimental consistency.<\/p>\n<hr \/>\n<h2 data-section-id=\"1pbh8fc\"><strong>Potentielle forskningsfordele<\/strong><\/h2>\n<ul>\n<li data-section-id=\"1pm95a8\">Cellular response markers related to growth factor signaling<\/li>\n<li data-section-id=\"1r9cuo2\">Tissue culture observations of anabolic pathway activation<\/li>\n<li data-section-id=\"1fytcje\">Stability of signaling activity in simulated metabolic environments<\/li>\n<li data-section-id=\"1k1mv77\">Receptor interaction potential with IGF-1 signaling pathways<\/li>\n<li data-section-id=\"1c1eyxc\">Angiogenic and proliferative pathway signaling markers<\/li>\n<\/ul>\n<hr \/>\n<h2 data-section-id=\"1tir0k8\"><strong>Eksperimentelle observationer<\/strong><\/h2>\n<p>Laboratory investigations involving IGF-1 LR3 peptide often observe enhanced signaling activity within IGF-1 receptor pathways in controlled experimental conditions. In vitro cell culture models demonstrate measurable changes in cellular proliferation markers and protein synthesis indicators. Researchers studying metabolic signaling frequently document changes in nutrient uptake pathways when IGF-1 LR3 is introduced to experimental systems. Pre-clinical models have also examined IGF-1 LR3 in relation to differentiation signaling and cellular development patterns. These observations contribute to understanding how sustained receptor activation influences complex cellular networks. IGF-1 LR3 for research therefore provides a reproducible framework for studying anabolic signaling pathways in experimental research settings.<\/p>\n<hr \/>\n<h2 data-section-id=\"1pt12ft\"><strong>Forskningsovervejelser<\/strong><\/h2>\n<p>Researchers working with IGF-1 LR3 should ensure strict laboratory protocols are followed to maintain peptide stability and experimental validity. Environmental conditions such as temperature, solvent compatibility, and assay sensitivity can influence peptide behavior in vitro studies. Careful calibration of concentrations is recommended before initiating extended laboratory investigation. IGF-1 LR3 peptide may interact with other growth factors or signaling molecules within complex experimental systems. Documentation of handling procedures and experimental parameters is essential for reproducibility. All work involving IGF-1 LR3 must remain within approved research and laboratory use guidelines.<\/p>\n<hr \/>\n<h2 data-section-id=\"y0g1yb\"><strong>Sikkerhedsmeddelelse<\/strong><\/h2>\n<p>IGF-1 LR3 peptide should be handled using standard laboratory safety practices including protective equipment and appropriate containment procedures. Researchers must ensure that the compound is stored, handled, and disposed of according to institutional laboratory safety guidelines. Direct exposure should be minimized and laboratory-grade handling tools should be used when preparing experimental solutions. This peptide is intended exclusively for scientific investigation and must not be used outside of controlled research environments. IGF-1 LR3 is not approved for human or veterinary use and should only be used in professional research facilities.<\/p>\n<p>Ansvarsfraskrivelse: Dette produkt er udelukkende beregnet til laboratorieforskningsform\u00e5l og er ikke til humant eller veterin\u00e6rt brug. De leverede oplysninger er til uddannelsesm\u00e6ssig og videnskabelig reference og b\u00f8r ikke fortolkes som medicinsk r\u00e5dgivning eller anbefaling til nogen form for administration. Forskere skal f\u00f8lge alle g\u00e6ldende regler og institutionelle retningslinjer ved h\u00e5ndtering af dette materiale.<\/p>\n<hr \/>\n<h2 data-section-id=\"1xqr4ds\"><strong>Opbevaringsinformation<\/strong><\/h2>\n<p>Store lyophilized IGF-1 LR3 at \u221220\u00b0C for long-term storage to maintain peptide stability and structural integrity. For short-term laboratory use, the peptide may be stored at 2\u20138\u00b0C under controlled refrigeration conditions. Protect IGF-1 LR3 from direct light exposure to prevent degradation of the peptide structure. Avoid repeated freeze-thaw cycles as these may reduce peptide stability and affect experimental reproducibility. When stored properly, IGF-1 LR3 maintains a shelf life of approximately 36 months. Proper storage ensures reliable laboratory performance of lyophilized IGF-1 LR3 for research.<\/p>\n<h2><strong>Renhed &amp; Kvalitet<\/strong><\/h2>\n<p>All IGF-1 LR3 vials stocked by MedsBase are supplied at 99%+ HPLC purity in lyophilized form. A certificate of analysis (COA) is available on request \u2014 message our support team after placing your order and we will forward the batch-specific COA for the vials you received.<\/p>\n<h2>Ofte stillede sp\u00f8rgsm\u00e5l<\/h2>\n<h3>What is the regulatory status of IGF-1 LR3?<\/h3>\n<p>IGF-1 LR3 is <strong>ikke godkendt til terapeutisk brug hos mennesker<\/strong> i USA, Den Europ\u00e6iske Union, Storbritannien, Canada eller Australien. Det s\u00e6lges kun til forskningsform\u00e5l. Nogle peptider i denne klasse er blevet brugt i tidlige kliniske fors\u00f8g, men ingen st\u00f8rre reguleringsmyndighed har udstedt en markedsf\u00f8ringstilladelse for de indikationer, der diskuteres i den popul\u00e6re litteratur.<\/p>\n<h3>How is IGF-1 LR3 reconstituted?<\/h3>\n<p>Lyofiliseret peptider rekonstitueres typisk med bakteriostatisk vand eller sterilt vand til injektion (BWFI \/ SWFI) i en koncentration, der passer til den planlagte dosis. Tils\u00e6t fortyndingsmidlet langsomt ned ad indersiden af flasken \u2014 injicer ikke str\u00f8mmen direkte ned i pulverkagen eller ryst kraftigt, da begge dele denaturerer peptidet. R\u00f8r forsigtigt, indtil det er fuldst\u00e6ndigt opl\u00f8st. Rekonstituerede peptider opbevares typisk k\u00f8let ved 2\u20138\u00b0C.<\/p>\n<h3>How should IGF-1 LR3 be stored?<\/h3>\n<p>Lyofiliseret flasker er stabile i l\u00e6ngere tid, n\u00e5r de opbevares ved \u221220\u00b0C eller k\u00f8les ved 2\u20138\u00b0C, v\u00e6k fra direkte lys. Efter rekonstitution er de fleste peptider stabile i 14\u201330 dage under k\u00f8ling, afh\u00e6ngigt af bufferen og det specifikke peptid. L\u00e6s altid analysecertifikatet, der f\u00f8lger med flasken, for leverand\u00f8rens anbefalede opbevarings- og stabilitetsdata.<\/p>\n<h3>Hvad viser den offentliggjorte forskning?<\/h3>\n<p>The published literature on IGF-1 LR3 is summarized in our linked research guide. We separate preclinical (rodent \/ cell-culture) data, where it is consistent and reproducible, from clinical-trial data, where evidence is typically thinner. We also flag where popular online claims outrun the published record.<\/p>\n<h3>Is IGF-1 LR3 legal to order internationally?<\/h3>\n<p>Forskningspeptider befinder sig i et tvetydigt reguleringsrum. Importregler varierer efter land og har \u00e6ndret sig i flere jurisdiktioner over de seneste \u00e5r. Det er k\u00f8bers ansvar at bekr\u00e6fte importlovligheden i deres destinationsland f\u00f8r bestilling. MedsBase sender peptider worldwide via vores dedikerede peptidkurer; ordrer, der overtr\u00e6der destinationslandets importregler, kan blive tilbageholdt i tolden.<\/p>\n<h3>What is the half-life of IGF-1 LR3?<\/h3>\n<p>IGF-1 LR3 has an estimated half-life of 20\u201330 hours in preclinical research \u2014 dramatically longer than native IGF-1 (approximately 6\u20138 hours). The LR3 modification reduces IGF-binding protein (IGFBP) affinity, increasing the free (bioavailable) IGF-1 fraction in circulation and extending active duration.<\/p>\n<h3>How does IGF-1 LR3 differ from native IGF-1?<\/h3>\n<p>IGF-1 LR3 is an 83-amino-acid analog of the naturally occurring 70-amino-acid IGF-1. The LR3 modification significantly reduces binding to the six known IGF-binding proteins (IGFBPs), which normally sequester ~98% of endogenous IGF-1. This results in a substantially higher free-peptide fraction and extended half-life, making IGF-1 LR3 a preferred compound in research requiring prolonged IGF-1 receptor activation.<\/p>\n<h3>Can I order IGF-1 LR3 alongside other peptides?<\/h3>\n<p>Ja. Peptidordrer samles og sendes sammen via vores peptid-specifikke kurertjeneste. Lyofiliseret h\u00e6tteglas er temperaturstabile under standard international transport. Se vores peptidkategoriside for det fulde lager og sammenligningsguiden \u201cBedste peptider til recovery\u201d for stakkebetragtninger fra den offentliggjorte litteratur.<\/p>\n<p class=\"medsbase-bundle-link-2026-05-01\" data-marker=\"mb-bundle-link-peptide-healing-stack\">IGF-1 LR3 protocols frequently include BPC-157 and TB-500 for joint and tendon support during the IGF-driven anabolic phase; our <a href=\"\/da\/peptide-healing-stack\/\">Peptide Healing Stack (BPC-157 5 mg + TB-500 5 mg + bacteriostatisk vand)<\/a> bundles both lyophilised vials with reconstitution water at $0 peptide-shipping rate.<\/p>\n<p><!-- medsbase-related-alts-v1 --><\/p>\n<h2>Andre peptider til recovery- og pr\u00e6stationsforskning<\/h2>\n<ul>\n<li><a href=\"\/da\/bpc-157\/\"><strong>BPC-157<\/strong><\/a> \u2014 Body Protection Compound \u2014 forskning i sener, ligament og tarmsundhed<\/li>\n<li><a href=\"\/da\/tb-500\/\"><strong>TB-500<\/strong><\/a> \u2014 Thymosin Beta-4 fragment \u2014 forskning i bl\u00f8dt v\u00e6v og vascular genopretning<\/li>\n<li><a href=\"\/da\/ipamorelin\/\"><strong>Ipamorelin<\/strong><\/a> \u2014 Selektiv ghrelin agonist \u2014 ren GH-puls uden cortisol\/prolaktin<\/li>\n<li><a href=\"\/da\/cjc-1295-with-dac\/\"><strong>CJC-1295 with DAC<\/strong><\/a> \u2014 GHRH-analog med forl\u00e6nget halveringstid<\/li>\n<li><a href=\"\/da\/ghk-cu\/\"><strong>GHK-Cu<\/strong><\/a> \u2014 Kobberpeptid \u2014 forskning i hud og bindev\u00e6vsregeneration<\/li>\n<\/ul>\n<p><!-- medsbase-peptide-guide-cta --><\/p>\n<h2>Yderligere l\u00e6sning<\/h2>\n<div style=\"background: #f4f8fb; border-left: 4px solid #2c7cb0; padding: 18px 22px; margin: 18px 0; border-radius: 4px;\">\n<p style=\"margin: 0 0 8px 0;\"><strong>\ud83d\udcd6 L\u00e6r forskningen bag dette peptid<\/strong><\/p>\n<p style=\"margin: 0;\">L\u00e6s vores komplette evidensbaserede guide: <a href=\"https:\/\/medsbase.com\/da\/igf-1-lr3-peptide-guide\/\"><strong>IGF-1 LR3 \u2014 honest science, dosing &amp; safety<\/strong><\/a>. D\u00e6kker virkningsmekanisme, publiceret forskningsdata, typiske forskningsdoseringer, rekonstitutionsprotokoller, stakkebetragtninger og sikkerheds-\/kontraindikationsnoter.<\/p>\n<\/div>\n<div class=\"medsbase-trust-strip\" style=\"background: #f4f8fb; border: 1px solid #d8e3eb; padding: 12px 16px; margin: 16px 0; border-radius: 4px; font-size: 14px;\"><strong>Hvad du f\u00e5r med MedsBase:<\/strong> Forskningsgrad lyofiliserede peptider \u00b7 HPLC \u226599% renhed (COA p\u00e5 anmodning) \u00b7 Diskret temperaturstabil emballage \u00b7 Verdensomsp\u00e6ndende peptidkur\u00e9r \u00b7 1.400+ verificeret <a href=\"https:\/\/medsbase.com\/da\/reviews\/\">kundeanmeldelser<\/a><\/div>\n<p class=\"medsbase-reship-line\" style=\"font-size: 14px; color: #444; margin: 8px 0 18px;\">\ud83d\udce6 Hver ordre er d\u00e6kket af vores <a href=\"https:\/\/medsbase.com\/da\/medsbase-re-shipment-assurance-policy\/\"><strong>Reshipment Assurance Policy<\/strong><\/a> \u2014 hvis din pakke ikke ankommer inden for 20 hverdage, sender vi en erstatning.<\/p>\n<table class=\"medsbase-spec-table\" style=\"width: 100%; border-collapse: collapse; margin: 18px 0; font-size: 14px;\">\n<thead>\n<tr style=\"background: #2c7cb0; color: #fff;\">\n<th style=\"padding: 8px 12px; text-align: left; width: 30%;\">Specifikation<\/th>\n<th style=\"padding: 8px 12px; text-align: left;\">Detaljer<\/th>\n<\/tr>\n<\/thead>\n<tbody>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>CAS-nummer<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">946870-92-4<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Molekyl\u00e6r formel<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">C<sub>400<\/sub>H<sub>625<\/sub>N<sub>111<\/sub>O<sub>120<\/sub>S<sub>9<\/sub><\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Molekylv\u00e6gt<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">~9117.4 Da<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Sekvens<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Long R<sup>3<\/sup> IGF-1 (83 amino acids; N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA)<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Form<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Lyofiliseret pulver (eller som leveret)<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Renhed<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">\u226599% (HPLC verificeret, COA p\u00e5 anmodning)<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Opbevaring<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Lyophilized: 2\u20138\u00a0\u00b0C (refrigerator) for working stock; \u221220\u00a0\u00b0C for long-term storage of unopened vials. Reconstituted: 2\u20138\u00a0\u00b0C, use within ~30 days. Avoid vigorous agitation; large peptides denature with shaking. Do not freeze\u2013thaw the reconstituted solution.<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Opl\u00f8selighed<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Bakteriostatisk vand (anbefales) eller sterilt vand til kortere brugsperioder<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Til forskningsbrug<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Kun til laboratorieforskningsbrug. Ikke til humant eller veterin\u00e6rt diagnostisk eller terapeutisk brug.<\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n<p><!-- pep-seo-v1 --><\/p>","protected":false},"excerpt":{"rendered":"<p>\u2705 Supports cellular growth<br \/>\n\u2705 Enhances protein synthesis<br \/>\n\u2705 Promotes metabolic signaling<br \/>\n\u2705 Improves tissue regeneration<br \/>\n\u2705 Forbedrer cellul\u00e6r reparation<\/p>\n<p><strong>IGF-1 LR3<\/strong> indeholder syntetisk peptidforbindelse.<\/p>","protected":false},"featured_media":70960,"comment_status":"open","ping_status":"closed","template":"","meta":[],"product_brand":[],"product_cat":[5426],"product_tag":[5474],"class_list":{"0":"post-69022","1":"product","2":"type-product","3":"status-publish","4":"has-post-thumbnail","6":"product_cat-peptides","7":"product_tag-igf-1-lr3","9":"first","10":"instock","11":"shipping-taxable","12":"purchasable","13":"product-type-variable","14":"has-default-attributes"},"acf":[],"_links":{"self":[{"href":"https:\/\/medsbase.com\/da\/wp-json\/wp\/v2\/product\/69022","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/medsbase.com\/da\/wp-json\/wp\/v2\/product"}],"about":[{"href":"https:\/\/medsbase.com\/da\/wp-json\/wp\/v2\/types\/product"}],"replies":[{"embeddable":true,"href":"https:\/\/medsbase.com\/da\/wp-json\/wp\/v2\/comments?post=69022"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/medsbase.com\/da\/wp-json\/wp\/v2\/media\/70960"}],"wp:attachment":[{"href":"https:\/\/medsbase.com\/da\/wp-json\/wp\/v2\/media?parent=69022"}],"wp:term":[{"taxonomy":"product_brand","embeddable":true,"href":"https:\/\/medsbase.com\/da\/wp-json\/wp\/v2\/product_brand?post=69022"},{"taxonomy":"product_cat","embeddable":true,"href":"https:\/\/medsbase.com\/da\/wp-json\/wp\/v2\/product_cat?post=69022"},{"taxonomy":"product_tag","embeddable":true,"href":"https:\/\/medsbase.com\/da\/wp-json\/wp\/v2\/product_tag?post=69022"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}