{"id":69022,"date":"2026-03-13T12:06:16","date_gmt":"2026-03-13T12:06:16","guid":{"rendered":"https:\/\/medsbase.com\/?post_type=product&#038;p=69022"},"modified":"2026-05-21T07:14:11","modified_gmt":"2026-05-21T07:14:11","slug":"igf-1-lr3","status":"publish","type":"product","link":"https:\/\/medsbase.com\/nl\/igf-1-lr3\/","title":{"rendered":"IGF-1 LR3"},"content":{"rendered":"<p><!-- medsbase-tldr-answer --><\/p>\n<div style=\"background: #fff8e1; border-left: 4px solid #f5a623; padding: 18px 22px; margin: 18px 0; border-radius: 4px;\">\n<h3 style=\"margin: 0 0 8px 0; font-size: 16px; color: #1a4a6b;\">Quick Answer \u2014 What is IGF-1 LR3?<\/h3>\n<p style=\"margin: 0;\"><strong>IGF-1 LR3<\/strong> is een onderzoekspeptide geleverd als een lyofiliseerd poeder voor reconstitutie. Het wordt uitsluitend verkocht voor laboratorium- en onderzoeksdoeleinden en is <strong>niet goedgekeurd voor therapeutisch gebruik bij mensen<\/strong> door de FDA, EMA, MHRA of andere belangrijke geneesmiddelenregulators. De informatie op deze pagina beschrijft gepubliceerde preklinische en vroege klinische literatuur; het is geen medisch advies of doseringsrichtlijn. Lees onze gelinkte onderzoeksgids voor het volledige bewijsoverzicht.<\/p>\n<\/div>\n<h2 data-section-id=\"1v2vk1x\">IGF-1 LR3 Peptide<\/h2>\n<p><span style=\"font-size: 120%;\">IGF-1 LR3 (Insulin-Like Growth Factor-1 Long R3) is a modified analog of insulin-like growth factor-1 designed for research involving cellular growth signaling, anabolic pathways, and metabolic regulation. This extended variant contains structural modifications that increase its stability and prolong its biological activity compared to standard IGF-1, allowing researchers to study sustained IGF-1 receptor activation in laboratory models. IGF-1 LR3 interacts with IGF-1 receptors involved in cellular proliferation, protein synthesis, and nutrient utilization. Due to its extended half-life and reduced binding to IGF-binding proteins, it provides a useful framework for examining mechanisms related to tissue growth, metabolic efficiency, and cellular repair processes. Research studies suggest IGF-1 LR3 may support pathways associated with muscle cell growth, enhanced protein synthesis, improved recovery from physical stress, and regulation of glucose metabolism. Its activity also makes it valuable for investigating regenerative signaling, cellular differentiation, and anabolic responses in controlled experimental environments.<\/span><\/p>\n<hr \/>\n<h2 data-section-id=\"1bovg99\"><strong>Productoverzicht<\/strong><\/h2>\n<p>IGF-1 LR3 is a synthetic research peptide classified as a modified insulin-like growth factor analog engineered to extend biological stability and receptor interaction duration in laboratory models. With the molecular formula C400H625N111O115S9 and molar mass of 9117.60 g\/mol, IGF-1 LR3 peptide is widely studied in experimental research settings focusing on cellular growth pathways and metabolic signaling. Each vial contains 0.1 mg or 1 mg of lyophilized IGF-1 LR3 supplied in high purity lyophilized form designed for laboratory investigation. The peptide is valued for its structural modifications that reduce binding to IGF-binding proteins and prolong receptor activity in controlled research environments. Image alt-text example: \u201clyophilized IGF-1 LR3 peptide vial for laboratory research investigation.\u201d IGF-1 LR3 for research maintains stability under proper storage conditions with a shelf life of approximately 36 months and is intended strictly for research and laboratory use only.<\/p>\n<hr \/>\n<h2 data-section-id=\"engqt1\"><strong>Onderzoeksapplicaties<\/strong><\/h2>\n<p>IGF-1 LR3 peptide is commonly utilized in laboratory investigation of cellular growth signaling and anabolic pathway activity. In vitro studies frequently examine IGF-1 receptor activation and downstream intracellular signaling mechanisms associated with protein synthesis and nutrient utilization. Pre-clinical models use IGF-1 LR3 for research to analyze cellular proliferation patterns and metabolic regulation responses. Researchers also explore tissue culture environments where growth factor signaling can be measured under controlled experimental conditions. IGF-1 LR3 supports investigations into cellular differentiation, metabolic signaling cascades, and anabolic response pathways. These applications provide valuable insight into mechanisms associated with growth signaling networks in experimental research settings.<\/p>\n<hr \/>\n<h2 data-section-id=\"g6iwef\"><strong>Reconstitutie en hantering<\/strong><\/h2>\n<p>Lyophilized IGF-1 LR3 should be reconstituted using bacteriostatic water in a sterile laboratory environment. Researchers should apply strict aseptic technique when introducing solvent into the vial to preserve peptide integrity and experimental accuracy. Inject the solution slowly along the inner vial wall to prevent peptide destabilization. Avoid shaking the vial; instead, gently swirl until the lyophilized IGF-1 LR3 powder is fully dissolved. After reconstitution, store the solution at 2\u20138\u00b0C and maintain it in a controlled laboratory environment. Proper handling procedures help preserve the stability of IGF-1 LR3 peptide for consistent experimental outcomes.<\/p>\n<hr \/>\n<h2 data-section-id=\"evp82x\"><strong>Werkingsmechanisme<\/strong><\/h2>\n<p>IGF-1 LR3 peptide interacts primarily with insulin-like growth factor receptors involved in cellular growth and metabolic signaling. In experimental research settings, this interaction stimulates intracellular pathways related to protein synthesis, nutrient uptake, and cellular proliferation markers. The structural modification of IGF-1 LR3 reduces affinity for IGF-binding proteins, allowing sustained receptor activation in laboratory models. In vitro studies indicate that this prolonged signaling may influence pathways related to anabolic cellular responses. Researchers use IGF-1 LR3 for research to explore receptor activation dynamics and downstream molecular cascades. These mechanisms provide insight into regulatory processes associated with cellular growth and metabolic adaptation.<\/p>\n<hr \/>\n<h2 data-section-id=\"1dcajhc\"><strong>Onderzoeksdoseringrichtlijnen<\/strong><\/h2>\n<p>For research reference only \u2013 not for human use. Research dosing ranges reported in published experimental literature vary depending on the model system and assay design. In vitro investigations often use IGF-1 LR3 peptide concentrations measured in nanomolar to micromolar ranges depending on cell line sensitivity. Pre-clinical experimental models may adjust concentration parameters to evaluate receptor signaling responses and metabolic activity markers. Researchers should determine optimal concentration ranges through preliminary assay validation. Lyophilized IGF-1 LR3 should be prepared and measured carefully to maintain experimental consistency.<\/p>\n<hr \/>\n<h2 data-section-id=\"1pbh8fc\"><strong>Mogelijke onderzoeksvoordelen<\/strong><\/h2>\n<ul>\n<li data-section-id=\"1pm95a8\">Cellular response markers related to growth factor signaling<\/li>\n<li data-section-id=\"1r9cuo2\">Tissue culture observations of anabolic pathway activation<\/li>\n<li data-section-id=\"1fytcje\">Stability of signaling activity in simulated metabolic environments<\/li>\n<li data-section-id=\"1k1mv77\">Receptor interaction potential with IGF-1 signaling pathways<\/li>\n<li data-section-id=\"1c1eyxc\">Angiogenic and proliferative pathway signaling markers<\/li>\n<\/ul>\n<hr \/>\n<h2 data-section-id=\"1tir0k8\"><strong>Experimentele observaties<\/strong><\/h2>\n<p>Laboratory investigations involving IGF-1 LR3 peptide often observe enhanced signaling activity within IGF-1 receptor pathways in controlled experimental conditions. In vitro cell culture models demonstrate measurable changes in cellular proliferation markers and protein synthesis indicators. Researchers studying metabolic signaling frequently document changes in nutrient uptake pathways when IGF-1 LR3 is introduced to experimental systems. Pre-clinical models have also examined IGF-1 LR3 in relation to differentiation signaling and cellular development patterns. These observations contribute to understanding how sustained receptor activation influences complex cellular networks. IGF-1 LR3 for research therefore provides a reproducible framework for studying anabolic signaling pathways in experimental research settings.<\/p>\n<hr \/>\n<h2 data-section-id=\"1pt12ft\"><strong>Onderzoeksoverwegingen<\/strong><\/h2>\n<p>Researchers working with IGF-1 LR3 should ensure strict laboratory protocols are followed to maintain peptide stability and experimental validity. Environmental conditions such as temperature, solvent compatibility, and assay sensitivity can influence peptide behavior in vitro studies. Careful calibration of concentrations is recommended before initiating extended laboratory investigation. IGF-1 LR3 peptide may interact with other growth factors or signaling molecules within complex experimental systems. Documentation of handling procedures and experimental parameters is essential for reproducibility. All work involving IGF-1 LR3 must remain within approved research and laboratory use guidelines.<\/p>\n<hr \/>\n<h2 data-section-id=\"y0g1yb\"><strong>Veiligheidsmededeling<\/strong><\/h2>\n<p>IGF-1 LR3 peptide should be handled using standard laboratory safety practices including protective equipment and appropriate containment procedures. Researchers must ensure that the compound is stored, handled, and disposed of according to institutional laboratory safety guidelines. Direct exposure should be minimized and laboratory-grade handling tools should be used when preparing experimental solutions. This peptide is intended exclusively for scientific investigation and must not be used outside of controlled research environments. IGF-1 LR3 is not approved for human or veterinary use and should only be used in professional research facilities.<\/p>\n<p>Disclaimer: Dit product is strikt bedoeld voor laboratoriumonderzoeksdoeleinden en is niet voor menselijk of diergeneeskundig gebruik. De verstrekte informatie is voor educatieve en wetenschappelijke referentie en mag niet worden ge\u00efnterpreteerd als medisch advies of als een aanbeveling voor enige vorm van toediening. Onderzoekers moeten alle toepasselijke voorschriften en institutionele richtlijnen volgen bij het hanteren van dit materiaal.<\/p>\n<hr \/>\n<h2 data-section-id=\"1xqr4ds\"><strong>Bewaarinformatie<\/strong><\/h2>\n<p>Store lyophilized IGF-1 LR3 at \u221220\u00b0C for long-term storage to maintain peptide stability and structural integrity. For short-term laboratory use, the peptide may be stored at 2\u20138\u00b0C under controlled refrigeration conditions. Protect IGF-1 LR3 from direct light exposure to prevent degradation of the peptide structure. Avoid repeated freeze-thaw cycles as these may reduce peptide stability and affect experimental reproducibility. When stored properly, IGF-1 LR3 maintains a shelf life of approximately 36 months. Proper storage ensures reliable laboratory performance of lyophilized IGF-1 LR3 for research.<\/p>\n<h2><strong>Zuiverheid &amp; Kwaliteit<\/strong><\/h2>\n<p>All IGF-1 LR3 vials stocked by MedsBase are supplied at 99%+ HPLC purity in lyophilized form. A certificate of analysis (COA) is available on request \u2014 message our support team after placing your order and we will forward the batch-specific COA for the vials you received.<\/p>\n<h2>Veelgestelde vragen<\/h2>\n<h3>What is the regulatory status of IGF-1 LR3?<\/h3>\n<p>IGF-1 LR3 is <strong>niet goedgekeurd voor therapeutisch gebruik bij mensen<\/strong> in de Verenigde Staten, Europese Unie, Verenigd Koninkrijk, Canada of Australi\u00eb. Het wordt alleen verkocht voor onderzoeksdoeleinden. Sommige peptiden in deze klasse zijn gebruikt in vroege klinische onderzoeken, maar geen belangrijke regelgever heeft een marktvergunning afgegeven voor de indicaties die in de populaire literatuur worden besproken.<\/p>\n<h3>How is IGF-1 LR3 reconstituted?<\/h3>\n<p>Gevriesdroogde peptiden worden meestal gereconstitueerd met bacteriostatisch water of steriel water voor injectie (BWFI\/SWFI) in een concentratie die geschikt is voor de geplande dosering. Voeg het oplosmiddel langzaam toe langs de binnenwand van het flesje \u2014 injecteer de stroom niet direct in het poeder of schud krachtig, omdat beide het peptide denatureren. Draai voorzichtig tot het volledig is opgelost. Gereconstitueerde peptiden worden meestal gekoeld bewaard bij 2\u20138\u00b0C.<\/p>\n<h3>How should IGF-1 LR3 be stored?<\/h3>\n<p>Gevriesdroogde flesjes zijn langdurig stabiel wanneer ze worden bewaard bij \u221220\u00b0C of gekoeld bij 2\u20138\u00b0C, weg van direct licht. Na reconstitutie zijn de meeste peptiden 14\u201330 dagen stabiel in de koelkast, afhankelijk van de buffer en het specifieke peptide. Lees altijd het analyse-certificaat dat bij het flesje wordt geleverd voor de door de leverancier aanbevolen opslag- en stabiliteitsgegevens.<\/p>\n<h3>Wat laat het gepubliceerde onderzoek zien?<\/h3>\n<p>The published literature on IGF-1 LR3 is summarized in our linked research guide. We separate preclinical (rodent \/ cell-culture) data, where it is consistent and reproducible, from clinical-trial data, where evidence is typically thinner. We also flag where popular online claims outrun the published record.<\/p>\n<h3>Is IGF-1 LR3 legal to order internationally?<\/h3>\n<p>Onderzoekspeptiden bevinden zich in een grijs regelgevingsgebied. Importregels vari\u00ebren per land en zijn in verschillende rechtsgebieden de afgelopen jaren veranderd. Het is de verantwoordelijkheid van de koper om de importlegaliteit in het bestemmingsland te bevestigen voordat hij bestelt. MedsBase verzendt peptiden wereldwijd via onze speciale peptidekoerier; bestellingen die in strijd zijn met de importregels van het bestemmingsland kunnen door de douane worden tegengehouden.<\/p>\n<h3>What is the half-life of IGF-1 LR3?<\/h3>\n<p>IGF-1 LR3 has an estimated half-life of 20\u201330 hours in preclinical research \u2014 dramatically longer than native IGF-1 (approximately 6\u20138 hours). The LR3 modification reduces IGF-binding protein (IGFBP) affinity, increasing the free (bioavailable) IGF-1 fraction in circulation and extending active duration.<\/p>\n<h3>How does IGF-1 LR3 differ from native IGF-1?<\/h3>\n<p>IGF-1 LR3 is an 83-amino-acid analog of the naturally occurring 70-amino-acid IGF-1. The LR3 modification significantly reduces binding to the six known IGF-binding proteins (IGFBPs), which normally sequester ~98% of endogenous IGF-1. This results in a substantially higher free-peptide fraction and extended half-life, making IGF-1 LR3 a preferred compound in research requiring prolonged IGF-1 receptor activation.<\/p>\n<h3>Can I order IGF-1 LR3 alongside other peptides?<\/h3>\n<p>Ja. Peptidebestellingen worden gebundeld en samen verzonden via onze peptide-specifieke koeriersdienst. Lyofiliseerde flesjes zijn temperatuurstabiel gedurende de standaard internationale verzending. Zie onze peptidecategoriepagina voor het volledige assortiment en de \u201cBeste Peptiden voor Herstel\u201d vergelijkingsgids voor stapeloverwegingen uit de gepubliceerde literatuur.<\/p>\n<p class=\"medsbase-bundle-link-2026-05-01\" data-marker=\"mb-bundle-link-peptide-healing-stack\">IGF-1 LR3 protocols frequently include BPC-157 and TB-500 for joint and tendon support during the IGF-driven anabolic phase; our <a href=\"\/nl\/peptide-healing-stack\/\">Peptide Healing Stack (BPC-157 5 mg + TB-500 5 mg + bacteriostatisch water)<\/a> bundles both lyophilised vials with reconstitution water at $0 peptide-shipping rate.<\/p>\n<p><!-- medsbase-related-alts-v1 --><\/p>\n<h2>Andere Peptiden voor Herstel- en Prestatieonderzoek<\/h2>\n<ul>\n<li><a href=\"\/nl\/bpc-157\/\"><strong>BPC-157<\/strong><\/a> \u2014 Body Protection Compound \u2014 onderzoek naar pees-, ligament- en darmherstel<\/li>\n<li><a href=\"\/nl\/tb-500\/\"><strong>TB-500<\/strong><\/a> \u2014 Thymosine Beta-4 fragment \u2014 onderzoek naar zacht weefsel en vasculair herstel<\/li>\n<li><a href=\"\/nl\/ipamorelin\/\"><strong>Ipamorelin<\/strong><\/a> \u2014 Selectieve ghreline-agonist \u2014 schone GH-puls zonder cortisol\/prolactine<\/li>\n<li><a href=\"\/nl\/cjc-1295-with-dac\/\"><strong>CJC-1295 met DAC<\/strong><\/a> \u2014 GHRH-analoog met verlengde halfwaardetijd<\/li>\n<li><a href=\"\/nl\/ghk-cu\/\"><strong>GHK-Cu<\/strong><\/a> \u2014 Koperpeptide \u2014 onderzoek naar huid- en bindweefselregeneratie<\/li>\n<\/ul>\n<p><!-- medsbase-peptide-guide-cta --><\/p>\n<h2>Verder lezen<\/h2>\n<div style=\"background: #f4f8fb; border-left: 4px solid #2c7cb0; padding: 18px 22px; margin: 18px 0; border-radius: 4px;\">\n<p style=\"margin: 0 0 8px 0;\"><strong>\ud83d\udcd6 Lees het onderzoek achter dit peptide<\/strong><\/p>\n<p style=\"margin: 0;\">Lees onze volledige evidence-based gids: <a href=\"https:\/\/medsbase.com\/nl\/igf-1-lr3-peptide-guide\/\"><strong>IGF-1 LR3 \u2014 honest science, dosing &amp; safety<\/strong><\/a>. Behandelt het werkingsmechanisme, gepubliceerde onderzoeksgegevens, typische onderzoeksdoseringen, reconstitutieprotocollen, stapeloverwegingen en veiligheids-\/contra-indicatie notities.<\/p>\n<\/div>\n<div class=\"medsbase-trust-strip\" style=\"background: #f4f8fb; border: 1px solid #d8e3eb; padding: 12px 16px; margin: 16px 0; border-radius: 4px; font-size: 14px;\"><strong>Wat u krijgt bij MedsBase:<\/strong> Onderzoekskwaliteit lyofiliseerde peptiden \u00b7 HPLC \u226599% zuiverheid (COA op aanvraag) \u00b7 Discrete temperatuurstabiele verpakking \u00b7 Wereldwijde peptidekoerier \u00b7 1.400+ geverifieerd <a href=\"https:\/\/medsbase.com\/nl\/reviews\/\">klantbeoordelingen<\/a><\/div>\n<p class=\"medsbase-reship-line\" style=\"font-size: 14px; color: #444; margin: 8px 0 18px;\">\ud83d\udce6 Elke bestelling is gedekt door onze <a href=\"https:\/\/medsbase.com\/nl\/medsbase-re-shipment-assurance-policy\/\"><strong>Reshipment Assurance Policy<\/strong><\/a> \u2014 als uw pakket niet binnen 20 werkdagen arriveert, sturen wij het opnieuw.<\/p>\n<table class=\"medsbase-spec-table\" style=\"width: 100%; border-collapse: collapse; margin: 18px 0; font-size: 14px;\">\n<thead>\n<tr style=\"background: #2c7cb0; color: #fff;\">\n<th style=\"padding: 8px 12px; text-align: left; width: 30%;\">Specificatie<\/th>\n<th style=\"padding: 8px 12px; text-align: left;\">Detail<\/th>\n<\/tr>\n<\/thead>\n<tbody>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>CAS-nummer<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">946870-92-4<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Molecuulformule<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">C<sub>400<\/sub>H<sub>625<\/sub>N<sub>111<\/sub>O<sub>120<\/sub>S<sub>9<\/sub><\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Moleculair gewicht<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">~9117.4 Da<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Sequentie<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Long R<sup>3<\/sup> IGF-1 (83 amino acids; N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA)<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Form<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Lyofiliseerd poeder (of zoals geleverd)<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Zuiverheid<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">\u226599% (HPLC geverifieerd, COA op aanvraag)<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Opslag<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Lyophilized: 2\u20138\u00a0\u00b0C (refrigerator) for working stock; \u221220\u00a0\u00b0C for long-term storage of unopened vials. Reconstituted: 2\u20138\u00a0\u00b0C, use within ~30 days. Avoid vigorous agitation; large peptides denature with shaking. Do not freeze\u2013thaw the reconstituted solution.<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Oplosbaarheid<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Bacteriostatisch water (aanbevolen) of steriel water voor kortere gebruiksperioden<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Onderzoeksgebruik<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Alleen voor laboratoriumonderzoek. Niet voor humaan of veterinair diagnostisch of therapeutisch gebruik.<\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n<p><!-- pep-seo-v1 --><\/p>","protected":false},"excerpt":{"rendered":"<p>\u2705 Supports cellular growth<br \/>\n\u2705 Enhances protein synthesis<br \/>\n\u2705 Promotes metabolic signaling<br \/>\n\u2705 Improves tissue regeneration<br \/>\n\u2705 Stimuleert cellulair herstel<\/p>\n<p><strong>IGF-1 LR3<\/strong> bevat synthetisch peptideverbinding.<\/p>","protected":false},"featured_media":70960,"comment_status":"open","ping_status":"closed","template":"","meta":[],"product_brand":[],"product_cat":[5426],"product_tag":[5474],"class_list":{"0":"post-69022","1":"product","2":"type-product","3":"status-publish","4":"has-post-thumbnail","6":"product_cat-peptides","7":"product_tag-igf-1-lr3","9":"first","10":"instock","11":"shipping-taxable","12":"purchasable","13":"product-type-variable","14":"has-default-attributes"},"acf":[],"_links":{"self":[{"href":"https:\/\/medsbase.com\/nl\/wp-json\/wp\/v2\/product\/69022","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/medsbase.com\/nl\/wp-json\/wp\/v2\/product"}],"about":[{"href":"https:\/\/medsbase.com\/nl\/wp-json\/wp\/v2\/types\/product"}],"replies":[{"embeddable":true,"href":"https:\/\/medsbase.com\/nl\/wp-json\/wp\/v2\/comments?post=69022"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/medsbase.com\/nl\/wp-json\/wp\/v2\/media\/70960"}],"wp:attachment":[{"href":"https:\/\/medsbase.com\/nl\/wp-json\/wp\/v2\/media?parent=69022"}],"wp:term":[{"taxonomy":"product_brand","embeddable":true,"href":"https:\/\/medsbase.com\/nl\/wp-json\/wp\/v2\/product_brand?post=69022"},{"taxonomy":"product_cat","embeddable":true,"href":"https:\/\/medsbase.com\/nl\/wp-json\/wp\/v2\/product_cat?post=69022"},{"taxonomy":"product_tag","embeddable":true,"href":"https:\/\/medsbase.com\/nl\/wp-json\/wp\/v2\/product_tag?post=69022"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}