{"id":69022,"date":"2026-03-13T12:06:16","date_gmt":"2026-03-13T12:06:16","guid":{"rendered":"https:\/\/medsbase.com\/?post_type=product&#038;p=69022"},"modified":"2026-05-21T07:14:11","modified_gmt":"2026-05-21T07:14:11","slug":"igf-1-lr3","status":"publish","type":"product","link":"https:\/\/medsbase.com\/ro\/product\/igf-1-lr3\/","title":{"rendered":"IGF-1 LR3"},"content":{"rendered":"<p><!-- medsbase-tldr-answer --><\/p>\n<div style=\"background: #fff8e1; border-left: 4px solid #f5a623; padding: 18px 22px; margin: 18px 0; border-radius: 4px;\">\n<h3 style=\"margin: 0 0 8px 0; font-size: 16px; color: #1a4a6b;\">Quick Answer \u2014 What is IGF-1 LR3?<\/h3>\n<p style=\"margin: 0;\"><strong>IGF-1 LR3<\/strong> este un peptid de cercetare furnizat sub form\u0103 de pulbere liofilizat\u0103 pentru reconstituire. Este v\u00e2ndut exclusiv pentru aplica\u021bii de laborator \u0219i de cercetare \u0219i <strong>nu este aprobat pentru uz terapeutic uman<\/strong> de FDA, EMA, MHRA sau alte autorit\u0103\u021bi de reglementare ale medicamentelor. Informa\u021biile de pe aceast\u0103 pagin\u0103 descriu literatura preclinic\u0103 \u0219i clinic\u0103 timpurie publicat\u0103; nu reprezint\u0103 sfat medical sau \u00eendrum\u0103ri de dozare. Citi\u021bi ghidul nostru de cercetare pentru un rezumat complet al dovezilor.<\/p>\n<\/div>\n<h2 data-section-id=\"1v2vk1x\">IGF-1 LR3 Peptide<\/h2>\n<p><span style=\"font-size: 120%;\">IGF-1 LR3 (Insulin-Like Growth Factor-1 Long R3) is a modified analog of insulin-like growth factor-1 designed for research involving cellular growth signaling, anabolic pathways, and metabolic regulation. This extended variant contains structural modifications that increase its stability and prolong its biological activity compared to standard IGF-1, allowing researchers to study sustained IGF-1 receptor activation in laboratory models. IGF-1 LR3 interacts with IGF-1 receptors involved in cellular proliferation, protein synthesis, and nutrient utilization. Due to its extended half-life and reduced binding to IGF-binding proteins, it provides a useful framework for examining mechanisms related to tissue growth, metabolic efficiency, and cellular repair processes. Research studies suggest IGF-1 LR3 may support pathways associated with muscle cell growth, enhanced protein synthesis, improved recovery from physical stress, and regulation of glucose metabolism. Its activity also makes it valuable for investigating regenerative signaling, cellular differentiation, and anabolic responses in controlled experimental environments.<\/span><\/p>\n<hr \/>\n<h2 data-section-id=\"1bovg99\"><strong>Prezentare general\u0103 a produsului<\/strong><\/h2>\n<p>IGF-1 LR3 is a synthetic research peptide classified as a modified insulin-like growth factor analog engineered to extend biological stability and receptor interaction duration in laboratory models. With the molecular formula C400H625N111O115S9 and molar mass of 9117.60 g\/mol, IGF-1 LR3 peptide is widely studied in experimental research settings focusing on cellular growth pathways and metabolic signaling. Each vial contains 0.1 mg or 1 mg of lyophilized IGF-1 LR3 supplied in high purity lyophilized form designed for laboratory investigation. The peptide is valued for its structural modifications that reduce binding to IGF-binding proteins and prolong receptor activity in controlled research environments. Image alt-text example: \u201clyophilized IGF-1 LR3 peptide vial for laboratory research investigation.\u201d IGF-1 LR3 for research maintains stability under proper storage conditions with a shelf life of approximately 36 months and is intended strictly for research and laboratory use only.<\/p>\n<hr \/>\n<h2 data-section-id=\"engqt1\"><strong>Aplica\u021bii de cercetare<\/strong><\/h2>\n<p>IGF-1 LR3 peptide is commonly utilized in laboratory investigation of cellular growth signaling and anabolic pathway activity. In vitro studies frequently examine IGF-1 receptor activation and downstream intracellular signaling mechanisms associated with protein synthesis and nutrient utilization. Pre-clinical models use IGF-1 LR3 for research to analyze cellular proliferation patterns and metabolic regulation responses. Researchers also explore tissue culture environments where growth factor signaling can be measured under controlled experimental conditions. IGF-1 LR3 supports investigations into cellular differentiation, metabolic signaling cascades, and anabolic response pathways. These applications provide valuable insight into mechanisms associated with growth signaling networks in experimental research settings.<\/p>\n<hr \/>\n<h2 data-section-id=\"g6iwef\"><strong>Reconstituire \u0219i manipulare<\/strong><\/h2>\n<p>Lyophilized IGF-1 LR3 should be reconstituted using bacteriostatic water in a sterile laboratory environment. Researchers should apply strict aseptic technique when introducing solvent into the vial to preserve peptide integrity and experimental accuracy. Inject the solution slowly along the inner vial wall to prevent peptide destabilization. Avoid shaking the vial; instead, gently swirl until the lyophilized IGF-1 LR3 powder is fully dissolved. After reconstitution, store the solution at 2\u20138\u00b0C and maintain it in a controlled laboratory environment. Proper handling procedures help preserve the stability of IGF-1 LR3 peptide for consistent experimental outcomes.<\/p>\n<hr \/>\n<h2 data-section-id=\"evp82x\"><strong>Mecanism de ac\u021biune<\/strong><\/h2>\n<p>IGF-1 LR3 peptide interacts primarily with insulin-like growth factor receptors involved in cellular growth and metabolic signaling. In experimental research settings, this interaction stimulates intracellular pathways related to protein synthesis, nutrient uptake, and cellular proliferation markers. The structural modification of IGF-1 LR3 reduces affinity for IGF-binding proteins, allowing sustained receptor activation in laboratory models. In vitro studies indicate that this prolonged signaling may influence pathways related to anabolic cellular responses. Researchers use IGF-1 LR3 for research to explore receptor activation dynamics and downstream molecular cascades. These mechanisms provide insight into regulatory processes associated with cellular growth and metabolic adaptation.<\/p>\n<hr \/>\n<h2 data-section-id=\"1dcajhc\"><strong>Ghiduri de dozare pentru cercetare<\/strong><\/h2>\n<p>For research reference only \u2013 not for human use. Research dosing ranges reported in published experimental literature vary depending on the model system and assay design. In vitro investigations often use IGF-1 LR3 peptide concentrations measured in nanomolar to micromolar ranges depending on cell line sensitivity. Pre-clinical experimental models may adjust concentration parameters to evaluate receptor signaling responses and metabolic activity markers. Researchers should determine optimal concentration ranges through preliminary assay validation. Lyophilized IGF-1 LR3 should be prepared and measured carefully to maintain experimental consistency.<\/p>\n<hr \/>\n<h2 data-section-id=\"1pbh8fc\"><strong>Beneficii poten\u021biale \u00een cercetare<\/strong><\/h2>\n<ul>\n<li data-section-id=\"1pm95a8\">Cellular response markers related to growth factor signaling<\/li>\n<li data-section-id=\"1r9cuo2\">Tissue culture observations of anabolic pathway activation<\/li>\n<li data-section-id=\"1fytcje\">Stability of signaling activity in simulated metabolic environments<\/li>\n<li data-section-id=\"1k1mv77\">Receptor interaction potential with IGF-1 signaling pathways<\/li>\n<li data-section-id=\"1c1eyxc\">Angiogenic and proliferative pathway signaling markers<\/li>\n<\/ul>\n<hr \/>\n<h2 data-section-id=\"1tir0k8\"><strong>Observa\u021bii experimentale<\/strong><\/h2>\n<p>Laboratory investigations involving IGF-1 LR3 peptide often observe enhanced signaling activity within IGF-1 receptor pathways in controlled experimental conditions. In vitro cell culture models demonstrate measurable changes in cellular proliferation markers and protein synthesis indicators. Researchers studying metabolic signaling frequently document changes in nutrient uptake pathways when IGF-1 LR3 is introduced to experimental systems. Pre-clinical models have also examined IGF-1 LR3 in relation to differentiation signaling and cellular development patterns. These observations contribute to understanding how sustained receptor activation influences complex cellular networks. IGF-1 LR3 for research therefore provides a reproducible framework for studying anabolic signaling pathways in experimental research settings.<\/p>\n<hr \/>\n<h2 data-section-id=\"1pt12ft\"><strong>Considera\u021bii pentru cercetare<\/strong><\/h2>\n<p>Researchers working with IGF-1 LR3 should ensure strict laboratory protocols are followed to maintain peptide stability and experimental validity. Environmental conditions such as temperature, solvent compatibility, and assay sensitivity can influence peptide behavior in vitro studies. Careful calibration of concentrations is recommended before initiating extended laboratory investigation. IGF-1 LR3 peptide may interact with other growth factors or signaling molecules within complex experimental systems. Documentation of handling procedures and experimental parameters is essential for reproducibility. All work involving IGF-1 LR3 must remain within approved research and laboratory use guidelines.<\/p>\n<hr \/>\n<h2 data-section-id=\"y0g1yb\"><strong>Notificare de siguran\u021b\u0103<\/strong><\/h2>\n<p>IGF-1 LR3 peptide should be handled using standard laboratory safety practices including protective equipment and appropriate containment procedures. Researchers must ensure that the compound is stored, handled, and disposed of according to institutional laboratory safety guidelines. Direct exposure should be minimized and laboratory-grade handling tools should be used when preparing experimental solutions. This peptide is intended exclusively for scientific investigation and must not be used outside of controlled research environments. IGF-1 LR3 is not approved for human or veterinary use and should only be used in professional research facilities.<\/p>\n<p>Declinare de responsabilitate: Acest produs este destinat strict pentru scopuri de cercetare \u00een laborator \u0219i nu este pentru utilizare uman\u0103 sau veterinar\u0103. Informa\u021biile furnizate sunt pentru referin\u021b\u0103 educa\u021bional\u0103 \u0219i \u0219tiin\u021bific\u0103 \u0219i nu trebuie interpretate ca sfat medical sau ca recomandare pentru orice form\u0103 de administrare. Cercet\u0103torii trebuie s\u0103 urmeze toate reglement\u0103rile aplicabile \u0219i recomand\u0103rile institu\u021bionale atunci c\u00e2nd manipuleaz\u0103 acest material.<\/p>\n<hr \/>\n<h2 data-section-id=\"1xqr4ds\"><strong>Informa\u021bii de Depozitare<\/strong><\/h2>\n<p>Store lyophilized IGF-1 LR3 at \u221220\u00b0C for long-term storage to maintain peptide stability and structural integrity. For short-term laboratory use, the peptide may be stored at 2\u20138\u00b0C under controlled refrigeration conditions. Protect IGF-1 LR3 from direct light exposure to prevent degradation of the peptide structure. Avoid repeated freeze-thaw cycles as these may reduce peptide stability and affect experimental reproducibility. When stored properly, IGF-1 LR3 maintains a shelf life of approximately 36 months. Proper storage ensures reliable laboratory performance of lyophilized IGF-1 LR3 for research.<\/p>\n<h2><strong>Puritate \u0219i calitate<\/strong><\/h2>\n<p>All IGF-1 LR3 vials stocked by MedsBase are supplied at 99%+ HPLC purity in lyophilized form. A certificate of analysis (COA) is available on request \u2014 message our support team after placing your order and we will forward the batch-specific COA for the vials you received.<\/p>\n<h2>\u00centreb\u0103ri frecvente<\/h2>\n<h3>What is the regulatory status of IGF-1 LR3?<\/h3>\n<p>IGF-1 LR3 is <strong>nu este aprobat pentru uz terapeutic uman<\/strong> \u00een Statele Unite, Uniunea European\u0103, Marea Britanie, Canada sau Australia. Este v\u00e2ndut doar pentru aplica\u021bii de cercetare. Unele peptide din aceast\u0103 clas\u0103 au fost utilizate \u00een studii clinice de faz\u0103 timpurie, dar niciun regulator major nu a emis o autoriza\u021bie de comercializare pentru indica\u021biile discutate \u00een literatura popular\u0103.<\/p>\n<h3>How is IGF-1 LR3 reconstituted?<\/h3>\n<p>Peptidele liofilizate sunt de obicei reconstituite cu ap\u0103 bacteriostatic\u0103 sau ap\u0103 steril\u0103 pentru injectare (BWFI \/ SWFI) la o concentra\u021bie adecvat\u0103 pentru doza planificat\u0103. Ad\u0103uga\u021bi diluantul \u00eencet pe peretele interior al flaconului \u2014 nu injecta\u021bi jetul direct \u00een pulberea liofilizat\u0103 \u0219i nu agita\u021bi viguros, deoarece ambele ac\u021biuni pot denatura peptida. Amesteca\u021bi u\u0219or p\u00e2n\u0103 la dizolvare complet\u0103. Peptidele reconstituite sunt de obicei depozitate la frigider la 2\u20138\u00b0C.<\/p>\n<h3>How should IGF-1 LR3 be stored?<\/h3>\n<p>Vialele liofilizate sunt stabile pentru perioade \u00eendelungate atunci c\u00e2nd sunt depozitate la \u221220\u00b0C sau la frigider la 2\u20138\u00b0C, departe de lumina direct\u0103. Dup\u0103 reconstituire, majoritatea peptidelor sunt stabile timp de 14\u201330 de zile la frigider, \u00een func\u021bie de tampon \u0219i de peptidul specific. Consulta\u021bi \u00eentotdeauna certificatul de analiz\u0103 inclus cu vialul pentru recomand\u0103rile furnizorului privind depozitarea \u0219i datele de stabilitate.<\/p>\n<h3>Ce arat\u0103 cercet\u0103rile publicate?<\/h3>\n<p>The published literature on IGF-1 LR3 is summarized in our linked research guide. We separate preclinical (rodent \/ cell-culture) data, where it is consistent and reproducible, from clinical-trial data, where evidence is typically thinner. We also flag where popular online claims outrun the published record.<\/p>\n<h3>Is IGF-1 LR3 legal to order internationally?<\/h3>\n<p>Peptidele de cercetare ocup\u0103 un spa\u021biu regulator ambiguu. Regulile de import variaz\u0103 \u00een func\u021bie de \u021bar\u0103 \u0219i s-au schimbat \u00een mai multe jurisdic\u021bii \u00een ultimii ani. Este responsabilitatea cump\u0103r\u0103torului s\u0103 confirme legalitatea importului \u00een \u021bara de destina\u021bie \u00eenainte de a comanda. MedsBase expediaz\u0103 peptide \u00een \u00eentreaga lume prin curierul nostru dedicat; comenzile care contravin regulilor de import ale \u021b\u0103rii de destina\u021bie pot fi re\u021binute la vam\u0103.<\/p>\n<h3>What is the half-life of IGF-1 LR3?<\/h3>\n<p>IGF-1 LR3 has an estimated half-life of 20\u201330 hours in preclinical research \u2014 dramatically longer than native IGF-1 (approximately 6\u20138 hours). The LR3 modification reduces IGF-binding protein (IGFBP) affinity, increasing the free (bioavailable) IGF-1 fraction in circulation and extending active duration.<\/p>\n<h3>How does IGF-1 LR3 differ from native IGF-1?<\/h3>\n<p>IGF-1 LR3 is an 83-amino-acid analog of the naturally occurring 70-amino-acid IGF-1. The LR3 modification significantly reduces binding to the six known IGF-binding proteins (IGFBPs), which normally sequester ~98% of endogenous IGF-1. This results in a substantially higher free-peptide fraction and extended half-life, making IGF-1 LR3 a preferred compound in research requiring prolonged IGF-1 receptor activation.<\/p>\n<h3>Can I order IGF-1 LR3 alongside other peptides?<\/h3>\n<p>Da. Comenzile de peptide sunt grupate \u0219i expediate \u00eempreun\u0103 prin serviciul nostru de curier dedicat exclusiv peptidelor. Vialele liofilizate sunt stabile la temperatur\u0103 pe durata transportului interna\u021bional standard. Consulta\u021bi pagina noastr\u0103 de categorie de peptide pentru gama complet\u0103 stocat\u0103 \u0219i ghidul de compara\u021bie \u201cCele mai bune peptide pentru recuperare\u201d pentru considera\u021bii de stacking din literatura publicat\u0103.<\/p>\n<p class=\"medsbase-bundle-link-2026-05-01\" data-marker=\"mb-bundle-link-peptide-healing-stack\">IGF-1 LR3 protocols frequently include BPC-157 and TB-500 for joint and tendon support during the IGF-driven anabolic phase; our <a href=\"\/ro\/peptide-healing-stack\/\">Peptide Healing Stack (BPC-157 5 mg + TB-500 5 mg + ap\u0103 bacteriostatic\u0103)<\/a> bundles both lyophilised vials with reconstitution water at $0 peptide-shipping rate.<\/p>\n<p><!-- medsbase-related-alts-v1 --><\/p>\n<h2>Alte peptide pentru cercetare \u00een recuperare \u0219i performan\u021b\u0103<\/h2>\n<ul>\n<li><a href=\"\/ro\/bpc-157\/\"><strong>BPC-157<\/strong><\/a> \u2014 Compus de protec\u021bie corporal\u0103 \u2014 cercetare \u00een recuperarea tendonilor, ligamentelor \u0219i intestinului<\/li>\n<li><a href=\"\/ro\/tb-500\/\"><strong>TB-500<\/strong><\/a> \u2014 Fragment de Thymosin Beta-4 \u2014 cercetare \u00een recuperarea \u021besuturilor moi \u0219i vasculare<\/li>\n<li><a href=\"\/ro\/ipamorelin\/\"><strong>Ipamorelin<\/strong><\/a> \u2014 Agonist selectiv de ghrelin\u0103 \u2014 puls de hormon de cre\u0219tere f\u0103r\u0103 cortizol\/prolactin\u0103<\/li>\n<li><a href=\"\/ro\/cjc-1295-with-dac\/\"><strong>CJC-1295 cu DAC<\/strong><\/a> \u2014 Analog GHRH cu timp de \u00eenjum\u0103t\u0103\u021bire prelungit<\/li>\n<li><a href=\"\/ro\/ghk-cu\/\"><strong>GHK-Cu<\/strong><\/a> \u2014 Peptid de cupru \u2014 cercetare \u00een regenerarea pielii \u0219i a \u021besutului conjunctiv<\/li>\n<\/ul>\n<p><!-- medsbase-peptide-guide-cta --><\/p>\n<h2>Lectur\u0103 suplimentar\u0103<\/h2>\n<div style=\"background: #f4f8fb; border-left: 4px solid #2c7cb0; padding: 18px 22px; margin: 18px 0; border-radius: 4px;\">\n<p style=\"margin: 0 0 8px 0;\"><strong>\ud83d\udcd6 Afla\u021bi cercetarea din spatele acestui peptid<\/strong><\/p>\n<p style=\"margin: 0;\">Cititi ghidul nostru complet bazat pe dovezi: <a href=\"https:\/\/medsbase.com\/ro\/igf-1-lr3-peptide-guide\/\"><strong>IGF-1 LR3 \u2014 honest science, dosing &amp; safety<\/strong><\/a>. Acoper\u0103 mecanismul de ac\u021biune, datele din studiile publicate, gamele tipice de dozare pentru cercetare, protocoale de reconstituire, considera\u021bii de combinare \u0219i note de siguran\u021b\u0103\/contraindica\u021bii.<\/p>\n<\/div>\n<div class=\"medsbase-trust-strip\" style=\"background: #f4f8fb; border: 1px solid #d8e3eb; padding: 12px 16px; margin: 16px 0; border-radius: 4px; font-size: 14px;\"><strong>Ce beneficii ofer\u0103 MedsBase:<\/strong> Peptide liofilizate pentru cercetare \u00b7 puritate HPLC \u226599% (certificat de analiz\u0103 la cerere) \u00b7 Ambalaj discret stabil la temperatur\u0103 \u00b7 Curierat worldwide de peptide \u00b7 Peste 1.400 de recenzii verificate <a href=\"https:\/\/medsbase.com\/ro\/reviews\/\">ale clien\u021bilor<\/a><\/div>\n<p class=\"medsbase-reship-line\" style=\"font-size: 14px; color: #444; margin: 8px 0 18px;\">\ud83d\udce6 Fiecare comand\u0103 este acoperit\u0103 de politica noastr\u0103 de <a href=\"https:\/\/medsbase.com\/ro\/medsbase-re-shipment-assurance-policy\/\"><strong>Politica noastr\u0103 de Reexpediere Garantat\u0103<\/strong><\/a> \u2014 dac\u0103 coletul dumneavoastr\u0103 nu sose\u0219te \u00een 20 de zile lucr\u0103toare, \u00eel relivr\u0103m.<\/p>\n<table class=\"medsbase-spec-table\" style=\"width: 100%; border-collapse: collapse; margin: 18px 0; font-size: 14px;\">\n<thead>\n<tr style=\"background: #2c7cb0; color: #fff;\">\n<th style=\"padding: 8px 12px; text-align: left; width: 30%;\">Specifica\u021bii<\/th>\n<th style=\"padding: 8px 12px; text-align: left;\">Detaliu<\/th>\n<\/tr>\n<\/thead>\n<tbody>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Num\u0103r CAS<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">946870-92-4<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Formula molecular\u0103<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">C<sub>400<\/sub>H<sub>625<\/sub>N<sub>111<\/sub>O<sub>120<\/sub>S<sub>9<\/sub><\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Greutate molecular\u0103<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">~9117.4 Da<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Secven\u021b\u0103<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Long R<sup>3<\/sup> IGF-1 (83 amino acids; N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA)<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Form\u0103<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Pulbere liofilizat\u0103 (sau a\u0219a cum este furnizat)<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Puritate<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">\u226599% (verificat prin HPLC, COA la cerere)<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Depozitare<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Lyophilized: 2\u20138\u00a0\u00b0C (refrigerator) for working stock; \u221220\u00a0\u00b0C for long-term storage of unopened vials. Reconstituted: 2\u20138\u00a0\u00b0C, use within ~30 days. Avoid vigorous agitation; large peptides denature with shaking. Do not freeze\u2013thaw the reconstituted solution.<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Solubilitate<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Ap\u0103 bacteriostatic\u0103 (recomandat\u0103) sau ap\u0103 steril\u0103 pentru perioade mai scurte de utilizare<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Utilizare \u00een cercetare<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Doar pentru utilizare \u00een cercetare de laborator. Nu este destinat pentru uz diagnostic sau terapeutic uman sau veterinar.<\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n<p><!-- pep-seo-v1 --><\/p>","protected":false},"excerpt":{"rendered":"<p>\u2705 Supports cellular growth<br \/>\n\u2705 Enhances protein synthesis<br \/>\n\u2705 Promotes metabolic signaling<br \/>\n\u2705 Improves tissue regeneration<br \/>\n\u2705 Stimuleaz\u0103 repararea celular\u0103<\/p>\n<p><strong>IGF-1 LR3<\/strong> con\u021bine compus peptidic sintetic.<\/p>","protected":false},"featured_media":70960,"comment_status":"open","ping_status":"closed","template":"","meta":[],"product_brand":[],"product_cat":[5426],"product_tag":[5474],"class_list":{"0":"post-69022","1":"product","2":"type-product","3":"status-publish","4":"has-post-thumbnail","6":"product_cat-peptides","7":"product_tag-igf-1-lr3","9":"first","10":"instock","11":"shipping-taxable","12":"purchasable","13":"product-type-variable","14":"has-default-attributes"},"acf":[],"_links":{"self":[{"href":"https:\/\/medsbase.com\/ro\/wp-json\/wp\/v2\/product\/69022","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/medsbase.com\/ro\/wp-json\/wp\/v2\/product"}],"about":[{"href":"https:\/\/medsbase.com\/ro\/wp-json\/wp\/v2\/types\/product"}],"replies":[{"embeddable":true,"href":"https:\/\/medsbase.com\/ro\/wp-json\/wp\/v2\/comments?post=69022"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/medsbase.com\/ro\/wp-json\/wp\/v2\/media\/70960"}],"wp:attachment":[{"href":"https:\/\/medsbase.com\/ro\/wp-json\/wp\/v2\/media?parent=69022"}],"wp:term":[{"taxonomy":"product_brand","embeddable":true,"href":"https:\/\/medsbase.com\/ro\/wp-json\/wp\/v2\/product_brand?post=69022"},{"taxonomy":"product_cat","embeddable":true,"href":"https:\/\/medsbase.com\/ro\/wp-json\/wp\/v2\/product_cat?post=69022"},{"taxonomy":"product_tag","embeddable":true,"href":"https:\/\/medsbase.com\/ro\/wp-json\/wp\/v2\/product_tag?post=69022"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}