{"id":69022,"date":"2026-03-13T12:06:16","date_gmt":"2026-03-13T12:06:16","guid":{"rendered":"https:\/\/medsbase.com\/?post_type=product&#038;p=69022"},"modified":"2026-05-21T07:14:11","modified_gmt":"2026-05-21T07:14:11","slug":"igf-1-lr3","status":"publish","type":"product","link":"https:\/\/medsbase.com\/sv\/product\/igf-1-lr3\/","title":{"rendered":"IGF-1 LR3"},"content":{"rendered":"<p><!-- medsbase-tldr-answer --><\/p>\n<div style=\"background: #fff8e1; border-left: 4px solid #f5a623; padding: 18px 22px; margin: 18px 0; border-radius: 4px;\">\n<h3 style=\"margin: 0 0 8px 0; font-size: 16px; color: #1a4a6b;\">Quick Answer \u2014 What is IGF-1 LR3?<\/h3>\n<p style=\"margin: 0;\"><strong>IGF-1 LR3<\/strong> \u00e4r ett forskningspeptid som levereras som ett liofiliserat pulver f\u00f6r rekonstitution. Det s\u00e4ljs endast f\u00f6r laboratorie- och forsknings\u00e4ndam\u00e5l och \u00e4r <strong>inte godk\u00e4nt f\u00f6r terapeutisk anv\u00e4ndning hos m\u00e4nniskor<\/strong> av FDA, EMA, MHRA eller andra stora l\u00e4kemedelsmyndigheter. Informationen p\u00e5 denna sida beskriver publicerad preklinisk och tidig klinisk litteratur; det \u00e4r inte medicinsk r\u00e5dgivning eller doseringsv\u00e4gledning. L\u00e4s v\u00e5r l\u00e4nkade forskningsguide f\u00f6r en komplett sammanfattning av bevisen.<\/p>\n<\/div>\n<h2 data-section-id=\"1v2vk1x\">IGF-1 LR3 Peptide<\/h2>\n<p><span style=\"font-size: 120%;\">IGF-1 LR3 (Insulin-Like Growth Factor-1 Long R3) is a modified analog of insulin-like growth factor-1 designed for research involving cellular growth signaling, anabolic pathways, and metabolic regulation. This extended variant contains structural modifications that increase its stability and prolong its biological activity compared to standard IGF-1, allowing researchers to study sustained IGF-1 receptor activation in laboratory models. IGF-1 LR3 interacts with IGF-1 receptors involved in cellular proliferation, protein synthesis, and nutrient utilization. Due to its extended half-life and reduced binding to IGF-binding proteins, it provides a useful framework for examining mechanisms related to tissue growth, metabolic efficiency, and cellular repair processes. Research studies suggest IGF-1 LR3 may support pathways associated with muscle cell growth, enhanced protein synthesis, improved recovery from physical stress, and regulation of glucose metabolism. Its activity also makes it valuable for investigating regenerative signaling, cellular differentiation, and anabolic responses in controlled experimental environments.<\/span><\/p>\n<hr \/>\n<h2 data-section-id=\"1bovg99\"><strong>Produkt\u00f6versikt<\/strong><\/h2>\n<p>IGF-1 LR3 is a synthetic research peptide classified as a modified insulin-like growth factor analog engineered to extend biological stability and receptor interaction duration in laboratory models. With the molecular formula C400H625N111O115S9 and molar mass of 9117.60 g\/mol, IGF-1 LR3 peptide is widely studied in experimental research settings focusing on cellular growth pathways and metabolic signaling. Each vial contains 0.1 mg or 1 mg of lyophilized IGF-1 LR3 supplied in high purity lyophilized form designed for laboratory investigation. The peptide is valued for its structural modifications that reduce binding to IGF-binding proteins and prolong receptor activity in controlled research environments. Image alt-text example: \u201clyophilized IGF-1 LR3 peptide vial for laboratory research investigation.\u201d IGF-1 LR3 for research maintains stability under proper storage conditions with a shelf life of approximately 36 months and is intended strictly for research and laboratory use only.<\/p>\n<hr \/>\n<h2 data-section-id=\"engqt1\"><strong>Forskningsapplikationer<\/strong><\/h2>\n<p>IGF-1 LR3 peptide is commonly utilized in laboratory investigation of cellular growth signaling and anabolic pathway activity. In vitro studies frequently examine IGF-1 receptor activation and downstream intracellular signaling mechanisms associated with protein synthesis and nutrient utilization. Pre-clinical models use IGF-1 LR3 for research to analyze cellular proliferation patterns and metabolic regulation responses. Researchers also explore tissue culture environments where growth factor signaling can be measured under controlled experimental conditions. IGF-1 LR3 supports investigations into cellular differentiation, metabolic signaling cascades, and anabolic response pathways. These applications provide valuable insight into mechanisms associated with growth signaling networks in experimental research settings.<\/p>\n<hr \/>\n<h2 data-section-id=\"g6iwef\"><strong>Rekonstitution och hantering<\/strong><\/h2>\n<p>Lyophilized IGF-1 LR3 should be reconstituted using bacteriostatic water in a sterile laboratory environment. Researchers should apply strict aseptic technique when introducing solvent into the vial to preserve peptide integrity and experimental accuracy. Inject the solution slowly along the inner vial wall to prevent peptide destabilization. Avoid shaking the vial; instead, gently swirl until the lyophilized IGF-1 LR3 powder is fully dissolved. After reconstitution, store the solution at 2\u20138\u00b0C and maintain it in a controlled laboratory environment. Proper handling procedures help preserve the stability of IGF-1 LR3 peptide for consistent experimental outcomes.<\/p>\n<hr \/>\n<h2 data-section-id=\"evp82x\"><strong>Verkningsmekanism<\/strong><\/h2>\n<p>IGF-1 LR3 peptide interacts primarily with insulin-like growth factor receptors involved in cellular growth and metabolic signaling. In experimental research settings, this interaction stimulates intracellular pathways related to protein synthesis, nutrient uptake, and cellular proliferation markers. The structural modification of IGF-1 LR3 reduces affinity for IGF-binding proteins, allowing sustained receptor activation in laboratory models. In vitro studies indicate that this prolonged signaling may influence pathways related to anabolic cellular responses. Researchers use IGF-1 LR3 for research to explore receptor activation dynamics and downstream molecular cascades. These mechanisms provide insight into regulatory processes associated with cellular growth and metabolic adaptation.<\/p>\n<hr \/>\n<h2 data-section-id=\"1dcajhc\"><strong>Riktlinjer f\u00f6r forskningsdosering<\/strong><\/h2>\n<p>For research reference only \u2013 not for human use. Research dosing ranges reported in published experimental literature vary depending on the model system and assay design. In vitro investigations often use IGF-1 LR3 peptide concentrations measured in nanomolar to micromolar ranges depending on cell line sensitivity. Pre-clinical experimental models may adjust concentration parameters to evaluate receptor signaling responses and metabolic activity markers. Researchers should determine optimal concentration ranges through preliminary assay validation. Lyophilized IGF-1 LR3 should be prepared and measured carefully to maintain experimental consistency.<\/p>\n<hr \/>\n<h2 data-section-id=\"1pbh8fc\"><strong>Potentiella forskningsf\u00f6rdelar<\/strong><\/h2>\n<ul>\n<li data-section-id=\"1pm95a8\">Cellular response markers related to growth factor signaling<\/li>\n<li data-section-id=\"1r9cuo2\">Tissue culture observations of anabolic pathway activation<\/li>\n<li data-section-id=\"1fytcje\">Stability of signaling activity in simulated metabolic environments<\/li>\n<li data-section-id=\"1k1mv77\">Receptor interaction potential with IGF-1 signaling pathways<\/li>\n<li data-section-id=\"1c1eyxc\">Angiogenic and proliferative pathway signaling markers<\/li>\n<\/ul>\n<hr \/>\n<h2 data-section-id=\"1tir0k8\"><strong>Experimentella observationer<\/strong><\/h2>\n<p>Laboratory investigations involving IGF-1 LR3 peptide often observe enhanced signaling activity within IGF-1 receptor pathways in controlled experimental conditions. In vitro cell culture models demonstrate measurable changes in cellular proliferation markers and protein synthesis indicators. Researchers studying metabolic signaling frequently document changes in nutrient uptake pathways when IGF-1 LR3 is introduced to experimental systems. Pre-clinical models have also examined IGF-1 LR3 in relation to differentiation signaling and cellular development patterns. These observations contribute to understanding how sustained receptor activation influences complex cellular networks. IGF-1 LR3 for research therefore provides a reproducible framework for studying anabolic signaling pathways in experimental research settings.<\/p>\n<hr \/>\n<h2 data-section-id=\"1pt12ft\"><strong>Forsknings\u00f6verv\u00e4ganden<\/strong><\/h2>\n<p>Researchers working with IGF-1 LR3 should ensure strict laboratory protocols are followed to maintain peptide stability and experimental validity. Environmental conditions such as temperature, solvent compatibility, and assay sensitivity can influence peptide behavior in vitro studies. Careful calibration of concentrations is recommended before initiating extended laboratory investigation. IGF-1 LR3 peptide may interact with other growth factors or signaling molecules within complex experimental systems. Documentation of handling procedures and experimental parameters is essential for reproducibility. All work involving IGF-1 LR3 must remain within approved research and laboratory use guidelines.<\/p>\n<hr \/>\n<h2 data-section-id=\"y0g1yb\"><strong>S\u00e4kerhetsmeddelande<\/strong><\/h2>\n<p>IGF-1 LR3 peptide should be handled using standard laboratory safety practices including protective equipment and appropriate containment procedures. Researchers must ensure that the compound is stored, handled, and disposed of according to institutional laboratory safety guidelines. Direct exposure should be minimized and laboratory-grade handling tools should be used when preparing experimental solutions. This peptide is intended exclusively for scientific investigation and must not be used outside of controlled research environments. IGF-1 LR3 is not approved for human or veterinary use and should only be used in professional research facilities.<\/p>\n<p>Ansvarsfriskrivning: Denna produkt \u00e4r avsedd strikt f\u00f6r laboratorieforsknings\u00e4ndam\u00e5l endast och \u00e4r inte f\u00f6r m\u00e4nsklig eller veterin\u00e4r anv\u00e4ndning. Den tillhandah\u00e5llna informationen \u00e4r f\u00f6r utbildnings- och vetenskapligt referens\u00e4ndam\u00e5l och ska inte tolkas som medicinsk r\u00e5dgivning eller som en rekommendation f\u00f6r n\u00e5gon form av administrering. Forskare b\u00f6r f\u00f6lja alla till\u00e4mpliga f\u00f6reskrifter och institutionella riktlinjer vid hantering av detta material.<\/p>\n<hr \/>\n<h2 data-section-id=\"1xqr4ds\"><strong>F\u00f6rvaringsinformation<\/strong><\/h2>\n<p>Store lyophilized IGF-1 LR3 at \u221220\u00b0C for long-term storage to maintain peptide stability and structural integrity. For short-term laboratory use, the peptide may be stored at 2\u20138\u00b0C under controlled refrigeration conditions. Protect IGF-1 LR3 from direct light exposure to prevent degradation of the peptide structure. Avoid repeated freeze-thaw cycles as these may reduce peptide stability and affect experimental reproducibility. When stored properly, IGF-1 LR3 maintains a shelf life of approximately 36 months. Proper storage ensures reliable laboratory performance of lyophilized IGF-1 LR3 for research.<\/p>\n<h2><strong>Renhet &amp; Kvalitet<\/strong><\/h2>\n<p>All IGF-1 LR3 vials stocked by MedsBase are supplied at 99%+ HPLC purity in lyophilized form. A certificate of analysis (COA) is available on request \u2014 message our support team after placing your order and we will forward the batch-specific COA for the vials you received.<\/p>\n<h2>Vanliga fr\u00e5gor<\/h2>\n<h3>What is the regulatory status of IGF-1 LR3?<\/h3>\n<p>IGF-1 LR3 is <strong>inte godk\u00e4nt f\u00f6r terapeutisk anv\u00e4ndning hos m\u00e4nniskor<\/strong> i USA, Europeiska unionen, Storbritannien, Kanada eller Australien. Den s\u00e4ljs endast f\u00f6r forsknings\u00e4ndam\u00e5l. Vissa peptider i denna klass har anv\u00e4nts i tidiga kliniska pr\u00f6vningar men ingen st\u00f6rre tillsynsmyndighet har utf\u00e4rdat ett marknadsgodk\u00e4nnande f\u00f6r de indikationer som diskuteras i popul\u00e4rlitteraturen.<\/p>\n<h3>How is IGF-1 LR3 reconstituted?<\/h3>\n<p>Lyofiliserade peptider rekonstitueras vanligtvis med bakteriostatisk vatten eller sterilt vatten f\u00f6r injektion (BWFI \/ SWFI) i en koncentration som \u00e4r l\u00e4mplig f\u00f6r den planerade dosen. Tills\u00e4tt diluenten l\u00e5ngsamt nerf\u00f6r flaskan insida \u2014 injicera inte str\u00e5len direkt i pulverkakan eller skaka kraftigt, eftersom b\u00e5da kan denaturera peptiden. Virvla f\u00f6rsiktigt tills den \u00e4r helt l\u00f6st. Rekonstituerade peptider f\u00f6rvaras vanligtvis kylda vid 2\u20138\u00b0C.<\/p>\n<h3>How should IGF-1 LR3 be stored?<\/h3>\n<p>Lyofiliserade flaskor \u00e4r stabila under l\u00e5ng tid n\u00e4r de f\u00f6rvaras vid \u221220\u00b0C eller kylda vid 2\u20138\u00b0C, bort fr\u00e5n direkt ljus. Efter rekonstitution \u00e4r de flesta peptider stabila i 14\u201330 dagar under kylning, beroende p\u00e5 buffert och specifik peptid. L\u00e4s alltid analyscertifikatet som medf\u00f6ljer flaskan f\u00f6r leverant\u00f6rens rekommenderade f\u00f6rvarings- och stabilitetsdata.<\/p>\n<h3>Vad visar den publicerade forskningen?<\/h3>\n<p>The published literature on IGF-1 LR3 is summarized in our linked research guide. We separate preclinical (rodent \/ cell-culture) data, where it is consistent and reproducible, from clinical-trial data, where evidence is typically thinner. We also flag where popular online claims outrun the published record.<\/p>\n<h3>Is IGF-1 LR3 legal to order internationally?<\/h3>\n<p>Forskningspeptider befinner sig i ett gr\u00e4nsland n\u00e4r det g\u00e4ller regelverk. Importregler varierar mellan l\u00e4nder och har \u00e4ndrats i flera jurisdiktioner under de senaste \u00e5ren. Det \u00e4r k\u00f6parens ansvar att kontrollera importens laglighet i destinationslandet innan best\u00e4llning g\u00f6rs. MedsBase skickar peptider \u00f6ver hela v\u00e4rlden via v\u00e5r dedikerade peptidkurir; best\u00e4llningar som bryter mot destinationslandets importregler kan h\u00e5llas kvar i tullen.<\/p>\n<h3>What is the half-life of IGF-1 LR3?<\/h3>\n<p>IGF-1 LR3 has an estimated half-life of 20\u201330 hours in preclinical research \u2014 dramatically longer than native IGF-1 (approximately 6\u20138 hours). The LR3 modification reduces IGF-binding protein (IGFBP) affinity, increasing the free (bioavailable) IGF-1 fraction in circulation and extending active duration.<\/p>\n<h3>How does IGF-1 LR3 differ from native IGF-1?<\/h3>\n<p>IGF-1 LR3 is an 83-amino-acid analog of the naturally occurring 70-amino-acid IGF-1. The LR3 modification significantly reduces binding to the six known IGF-binding proteins (IGFBPs), which normally sequester ~98% of endogenous IGF-1. This results in a substantially higher free-peptide fraction and extended half-life, making IGF-1 LR3 a preferred compound in research requiring prolonged IGF-1 receptor activation.<\/p>\n<h3>Can I order IGF-1 LR3 alongside other peptides?<\/h3>\n<p>Ja. Peptidbest\u00e4llningar samlas ihop och skickas tillsammans via v\u00e5r specialiserade peptidkurirtj\u00e4nst. Lyofiliserade flaskor \u00e4r temperaturstabila under standardtransporter internationellt. Se v\u00e5r peptidkategorisida f\u00f6r hela utbudet och j\u00e4mf\u00f6relseguiden \u201cB\u00e4sta peptider f\u00f6r \u00e5terh\u00e4mtning\u201d f\u00f6r \u00f6verv\u00e4ganden om kombinationer fr\u00e5n publicerad litteratur.<\/p>\n<p class=\"medsbase-bundle-link-2026-05-01\" data-marker=\"mb-bundle-link-peptide-healing-stack\">IGF-1 LR3 protocols frequently include BPC-157 and TB-500 for joint and tendon support during the IGF-driven anabolic phase; our <a href=\"\/sv\/peptide-healing-stack\/\">Peptide Healing Stack (BPC-157 5 mg + TB-500 5 mg + bakteriostatisk vatten)<\/a> bundles both lyophilised vials with reconstitution water at $0 peptide-shipping rate.<\/p>\n<p><!-- medsbase-related-alts-v1 --><\/p>\n<h2>Andra peptider f\u00f6r forskning om \u00e5terh\u00e4mtning och prestanda<\/h2>\n<ul>\n<li><a href=\"\/sv\/bpc-157\/\"><strong>BPC-157<\/strong><\/a> \u2014 Body Protection Compound \u2014 forskning om \u00e5terh\u00e4mtning av senor, ligament och tarm<\/li>\n<li><a href=\"\/sv\/tb-500\/\"><strong>TB-500<\/strong><\/a> \u2014 Thymosin Beta-4 fragment \u2014 forskning om \u00e5terh\u00e4mtning av mjukv\u00e4vnad och blodk\u00e4rl<\/li>\n<li><a href=\"\/sv\/ipamorelin\/\"><strong>Ipamorelin<\/strong><\/a> \u2014 Selektiv ghrelinagonist \u2014 ren GH-puls utan kortisol\/prolaktin<\/li>\n<li><a href=\"\/sv\/cjc-1295-with-dac\/\"><strong>CJC-1295 med DAC<\/strong><\/a> \u2014 GHRH-analog med f\u00f6rl\u00e4ngd halveringstid<\/li>\n<li><a href=\"\/sv\/ghk-cu\/\"><strong>GHK-Cu<\/strong><\/a> \u2014 Kopparpeptid \u2014 forskning om hud- och bindv\u00e4vsregeneration<\/li>\n<\/ul>\n<p><!-- medsbase-peptide-guide-cta --><\/p>\n<h2>Vidarel\u00e4sning<\/h2>\n<div style=\"background: #f4f8fb; border-left: 4px solid #2c7cb0; padding: 18px 22px; margin: 18px 0; border-radius: 4px;\">\n<p style=\"margin: 0 0 8px 0;\"><strong>\ud83d\udcd6 L\u00e4r dig forskningen bakom denna peptid<\/strong><\/p>\n<p style=\"margin: 0;\">L\u00e4s v\u00e5r kompletta evidensbaserade guide: <a href=\"https:\/\/medsbase.com\/sv\/igf-1-lr3-peptide-guide\/\"><strong>IGF-1 LR3 \u2014 honest science, dosing &amp; safety<\/strong><\/a>. T\u00e4cker verkningsmekanism, publicerad studiedata, typiska forskningsdoseringsintervall, rekonstitutionsprotokoll, stacknings\u00f6verv\u00e4ganden och s\u00e4kerhets-\/kontraindikationsanteckningar.<\/p>\n<\/div>\n<div class=\"medsbase-trust-strip\" style=\"background: #f4f8fb; border: 1px solid #d8e3eb; padding: 12px 16px; margin: 16px 0; border-radius: 4px; font-size: 14px;\"><strong>Vad du f\u00e5r med MedsBase:<\/strong> Forskningsgrad av liofiliserade peptider \u00b7 HPLC \u226599% renhet (COA p\u00e5 beg\u00e4ran) \u00b7 Diskret temperaturstabil f\u00f6rpackning \u00b7 Peptidbud \u00f6ver hela v\u00e4rlden \u00b7 1 400+ verifierade <a href=\"https:\/\/medsbase.com\/sv\/reviews\/\">kundrecensioner<\/a><\/div>\n<p class=\"medsbase-reship-line\" style=\"font-size: 14px; color: #444; margin: 8px 0 18px;\">\ud83d\udce6 Varje best\u00e4llning omfattas av v\u00e5r <a href=\"https:\/\/medsbase.com\/sv\/medsbase-re-shipment-assurance-policy\/\"><strong>Reshipment Assurance Policy<\/strong><\/a> \u2014 om din f\u00f6rs\u00e4ndelse inte anl\u00e4nder inom 20 arbetsdagar, skickar vi om den.<\/p>\n<table class=\"medsbase-spec-table\" style=\"width: 100%; border-collapse: collapse; margin: 18px 0; font-size: 14px;\">\n<thead>\n<tr style=\"background: #2c7cb0; color: #fff;\">\n<th style=\"padding: 8px 12px; text-align: left; width: 30%;\">Specifikation<\/th>\n<th style=\"padding: 8px 12px; text-align: left;\">Detalj<\/th>\n<\/tr>\n<\/thead>\n<tbody>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>CAS-nummer<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">946870-92-4<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Molekylformel<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">C<sub>400<\/sub>H<sub>625<\/sub>N<sub>111<\/sub>O<sub>120<\/sub>S<sub>9<\/sub><\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Molekylvikt<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">~9117.4 Da<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Sekvens<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Long R<sup>3<\/sup> IGF-1 (83 amino acids; N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA)<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Form<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Lyofiliserat pulver (eller som levereras)<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Renhet<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">\u226599 % (HPLC-verifierat, COA p\u00e5 beg\u00e4ran)<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>F\u00f6rvaring<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Lyophilized: 2\u20138\u00a0\u00b0C (refrigerator) for working stock; \u221220\u00a0\u00b0C for long-term storage of unopened vials. Reconstituted: 2\u20138\u00a0\u00b0C, use within ~30 days. Avoid vigorous agitation; large peptides denature with shaking. Do not freeze\u2013thaw the reconstituted solution.<\/td>\n<\/tr>\n<tr style=\"background: #fff;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>L\u00f6slighet<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Bakteriostatisk vatten (rekommenderas) eller sterilt vatten f\u00f6r kortare anv\u00e4ndningsperioder<\/td>\n<\/tr>\n<tr style=\"background: #f9f9f9;\">\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0; width: 30%;\"><strong>Forskningsanv\u00e4ndning<\/strong><\/td>\n<td style=\"padding: 8px 12px; border-bottom: 1px solid #e0e0e0;\">Endast f\u00f6r laboratorieforskning. Ej avsedd f\u00f6r diagnostiskt eller terapeutiskt bruk p\u00e5 m\u00e4nniskor eller djur.<\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n<p><!-- pep-seo-v1 --><\/p>","protected":false},"excerpt":{"rendered":"<p>\u2705 Supports cellular growth<br \/>\n\u2705 Enhances protein synthesis<br \/>\n\u2705 Promotes metabolic signaling<br \/>\n\u2705 Improves tissue regeneration<br \/>\n\u2705 Stimulerar cellul\u00e4r reparation<\/p>\n<p><strong>IGF-1 LR3<\/strong> inneh\u00e5ller syntetiska peptidf\u00f6reningar.<\/p>","protected":false},"featured_media":70960,"comment_status":"open","ping_status":"closed","template":"","meta":[],"product_brand":[],"product_cat":[5426],"product_tag":[5474],"class_list":{"0":"post-69022","1":"product","2":"type-product","3":"status-publish","4":"has-post-thumbnail","6":"product_cat-peptides","7":"product_tag-igf-1-lr3","9":"first","10":"instock","11":"shipping-taxable","12":"purchasable","13":"product-type-variable","14":"has-default-attributes"},"acf":[],"_links":{"self":[{"href":"https:\/\/medsbase.com\/sv\/wp-json\/wp\/v2\/product\/69022","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/medsbase.com\/sv\/wp-json\/wp\/v2\/product"}],"about":[{"href":"https:\/\/medsbase.com\/sv\/wp-json\/wp\/v2\/types\/product"}],"replies":[{"embeddable":true,"href":"https:\/\/medsbase.com\/sv\/wp-json\/wp\/v2\/comments?post=69022"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/medsbase.com\/sv\/wp-json\/wp\/v2\/media\/70960"}],"wp:attachment":[{"href":"https:\/\/medsbase.com\/sv\/wp-json\/wp\/v2\/media?parent=69022"}],"wp:term":[{"taxonomy":"product_brand","embeddable":true,"href":"https:\/\/medsbase.com\/sv\/wp-json\/wp\/v2\/product_brand?post=69022"},{"taxonomy":"product_cat","embeddable":true,"href":"https:\/\/medsbase.com\/sv\/wp-json\/wp\/v2\/product_cat?post=69022"},{"taxonomy":"product_tag","embeddable":true,"href":"https:\/\/medsbase.com\/sv\/wp-json\/wp\/v2\/product_tag?post=69022"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}