Quick Answer — What is IGF-1 LR3?
IGF-1 LR3 er et forskningspeptid leveret som et lyofiliseret pulver til rekonstitution. Det sælges udelukkende til laboratorie- og forskningsformål og er ikke godkendt til terapeutisk brug hos mennesker af FDA, EMA, MHRA eller andre store lægemiddelmyndigheder. Oplysningerne på denne side beskriver offentliggjort præklinisk og tidlig klinisk litteratur; det er ikke medicinsk rådgivning eller doseringsvejledning. Læs vores tilknyttede forskningsguide for den komplette evidensoversigt.
IGF-1 LR3 Peptide
IGF-1 LR3 (Insulin-Like Growth Factor-1 Long R3) is a modified analog of insulin-like growth factor-1 designed for research involving cellular growth signaling, anabolic pathways, and metabolic regulation. This extended variant contains structural modifications that increase its stability and prolong its biological activity compared to standard IGF-1, allowing researchers to study sustained IGF-1 receptor activation in laboratory models. IGF-1 LR3 interacts with IGF-1 receptors involved in cellular proliferation, protein synthesis, and nutrient utilization. Due to its extended half-life and reduced binding to IGF-binding proteins, it provides a useful framework for examining mechanisms related to tissue growth, metabolic efficiency, and cellular repair processes. Research studies suggest IGF-1 LR3 may support pathways associated with muscle cell growth, enhanced protein synthesis, improved recovery from physical stress, and regulation of glucose metabolism. Its activity also makes it valuable for investigating regenerative signaling, cellular differentiation, and anabolic responses in controlled experimental environments.
Produktoverblik
IGF-1 LR3 is a synthetic research peptide classified as a modified insulin-like growth factor analog engineered to extend biological stability and receptor interaction duration in laboratory models. With the molecular formula C400H625N111O115S9 and molar mass of 9117.60 g/mol, IGF-1 LR3 peptide is widely studied in experimental research settings focusing on cellular growth pathways and metabolic signaling. Each vial contains 0.1 mg or 1 mg of lyophilized IGF-1 LR3 supplied in high purity lyophilized form designed for laboratory investigation. The peptide is valued for its structural modifications that reduce binding to IGF-binding proteins and prolong receptor activity in controlled research environments. Image alt-text example: “lyophilized IGF-1 LR3 peptide vial for laboratory research investigation.” IGF-1 LR3 for research maintains stability under proper storage conditions with a shelf life of approximately 36 months and is intended strictly for research and laboratory use only.
Forskningsapplikationer
IGF-1 LR3 peptide is commonly utilized in laboratory investigation of cellular growth signaling and anabolic pathway activity. In vitro studies frequently examine IGF-1 receptor activation and downstream intracellular signaling mechanisms associated with protein synthesis and nutrient utilization. Pre-clinical models use IGF-1 LR3 for research to analyze cellular proliferation patterns and metabolic regulation responses. Researchers also explore tissue culture environments where growth factor signaling can be measured under controlled experimental conditions. IGF-1 LR3 supports investigations into cellular differentiation, metabolic signaling cascades, and anabolic response pathways. These applications provide valuable insight into mechanisms associated with growth signaling networks in experimental research settings.
Rekonstitution og håndtering
Lyophilized IGF-1 LR3 should be reconstituted using bacteriostatic water in a sterile laboratory environment. Researchers should apply strict aseptic technique when introducing solvent into the vial to preserve peptide integrity and experimental accuracy. Inject the solution slowly along the inner vial wall to prevent peptide destabilization. Avoid shaking the vial; instead, gently swirl until the lyophilized IGF-1 LR3 powder is fully dissolved. After reconstitution, store the solution at 2–8°C and maintain it in a controlled laboratory environment. Proper handling procedures help preserve the stability of IGF-1 LR3 peptide for consistent experimental outcomes.
Virkningsmekanisme
IGF-1 LR3 peptide interacts primarily with insulin-like growth factor receptors involved in cellular growth and metabolic signaling. In experimental research settings, this interaction stimulates intracellular pathways related to protein synthesis, nutrient uptake, and cellular proliferation markers. The structural modification of IGF-1 LR3 reduces affinity for IGF-binding proteins, allowing sustained receptor activation in laboratory models. In vitro studies indicate that this prolonged signaling may influence pathways related to anabolic cellular responses. Researchers use IGF-1 LR3 for research to explore receptor activation dynamics and downstream molecular cascades. These mechanisms provide insight into regulatory processes associated with cellular growth and metabolic adaptation.
Undersøgelse af doseringsretningslinjer
For research reference only – not for human use. Research dosing ranges reported in published experimental literature vary depending on the model system and assay design. In vitro investigations often use IGF-1 LR3 peptide concentrations measured in nanomolar to micromolar ranges depending on cell line sensitivity. Pre-clinical experimental models may adjust concentration parameters to evaluate receptor signaling responses and metabolic activity markers. Researchers should determine optimal concentration ranges through preliminary assay validation. Lyophilized IGF-1 LR3 should be prepared and measured carefully to maintain experimental consistency.
Potentielle forskningsfordele
- Cellular response markers related to growth factor signaling
- Tissue culture observations of anabolic pathway activation
- Stability of signaling activity in simulated metabolic environments
- Receptor interaction potential with IGF-1 signaling pathways
- Angiogenic and proliferative pathway signaling markers
Eksperimentelle observationer
Laboratory investigations involving IGF-1 LR3 peptide often observe enhanced signaling activity within IGF-1 receptor pathways in controlled experimental conditions. In vitro cell culture models demonstrate measurable changes in cellular proliferation markers and protein synthesis indicators. Researchers studying metabolic signaling frequently document changes in nutrient uptake pathways when IGF-1 LR3 is introduced to experimental systems. Pre-clinical models have also examined IGF-1 LR3 in relation to differentiation signaling and cellular development patterns. These observations contribute to understanding how sustained receptor activation influences complex cellular networks. IGF-1 LR3 for research therefore provides a reproducible framework for studying anabolic signaling pathways in experimental research settings.
Forskningsovervejelser
Researchers working with IGF-1 LR3 should ensure strict laboratory protocols are followed to maintain peptide stability and experimental validity. Environmental conditions such as temperature, solvent compatibility, and assay sensitivity can influence peptide behavior in vitro studies. Careful calibration of concentrations is recommended before initiating extended laboratory investigation. IGF-1 LR3 peptide may interact with other growth factors or signaling molecules within complex experimental systems. Documentation of handling procedures and experimental parameters is essential for reproducibility. All work involving IGF-1 LR3 must remain within approved research and laboratory use guidelines.
Sikkerhedsmeddelelse
IGF-1 LR3 peptide should be handled using standard laboratory safety practices including protective equipment and appropriate containment procedures. Researchers must ensure that the compound is stored, handled, and disposed of according to institutional laboratory safety guidelines. Direct exposure should be minimized and laboratory-grade handling tools should be used when preparing experimental solutions. This peptide is intended exclusively for scientific investigation and must not be used outside of controlled research environments. IGF-1 LR3 is not approved for human or veterinary use and should only be used in professional research facilities.
Ansvarsfraskrivelse: Dette produkt er udelukkende beregnet til laboratorieforskningsformål og er ikke til humant eller veterinært brug. De leverede oplysninger er til uddannelsesmæssig og videnskabelig reference og bør ikke fortolkes som medicinsk rådgivning eller anbefaling til nogen form for administration. Forskere skal følge alle gældende regler og institutionelle retningslinjer ved håndtering af dette materiale.
Opbevaringsinformation
Store lyophilized IGF-1 LR3 at −20°C for long-term storage to maintain peptide stability and structural integrity. For short-term laboratory use, the peptide may be stored at 2–8°C under controlled refrigeration conditions. Protect IGF-1 LR3 from direct light exposure to prevent degradation of the peptide structure. Avoid repeated freeze-thaw cycles as these may reduce peptide stability and affect experimental reproducibility. When stored properly, IGF-1 LR3 maintains a shelf life of approximately 36 months. Proper storage ensures reliable laboratory performance of lyophilized IGF-1 LR3 for research.
Renhed & Kvalitet
All IGF-1 LR3 vials stocked by MedsBase are supplied at 99%+ HPLC purity in lyophilized form. A certificate of analysis (COA) is available on request — message our support team after placing your order and we will forward the batch-specific COA for the vials you received.
Ofte stillede spørgsmål
What is the regulatory status of IGF-1 LR3?
IGF-1 LR3 is ikke godkendt til terapeutisk brug hos mennesker i USA, Den Europæiske Union, Storbritannien, Canada eller Australien. Det sælges kun til forskningsformål. Nogle peptider i denne klasse er blevet brugt i tidlige kliniske forsøg, men ingen større reguleringsmyndighed har udstedt en markedsføringstilladelse for de indikationer, der diskuteres i den populære litteratur.
How is IGF-1 LR3 reconstituted?
Lyofiliseret peptider rekonstitueres typisk med bakteriostatisk vand eller sterilt vand til injektion (BWFI / SWFI) i en koncentration, der passer til den planlagte dosis. Tilsæt fortyndingsmidlet langsomt ned ad indersiden af flasken — injicer ikke strømmen direkte ned i pulverkagen eller ryst kraftigt, da begge dele denaturerer peptidet. Rør forsigtigt, indtil det er fuldstændigt opløst. Rekonstituerede peptider opbevares typisk kølet ved 2–8°C.
How should IGF-1 LR3 be stored?
Lyofiliseret flasker er stabile i længere tid, når de opbevares ved −20°C eller køles ved 2–8°C, væk fra direkte lys. Efter rekonstitution er de fleste peptider stabile i 14–30 dage under køling, afhængigt af bufferen og det specifikke peptid. Læs altid analysecertifikatet, der følger med flasken, for leverandørens anbefalede opbevarings- og stabilitetsdata.
Hvad viser den offentliggjorte forskning?
The published literature on IGF-1 LR3 is summarized in our linked research guide. We separate preclinical (rodent / cell-culture) data, where it is consistent and reproducible, from clinical-trial data, where evidence is typically thinner. We also flag where popular online claims outrun the published record.
Is IGF-1 LR3 legal to order internationally?
Forskningspeptider befinder sig i et tvetydigt reguleringsrum. Importregler varierer efter land og har ændret sig i flere jurisdiktioner over de seneste år. Det er købers ansvar at bekræfte importlovligheden i deres destinationsland før bestilling. MedsBase sender peptider worldwide via vores dedikerede peptidkurer; ordrer, der overtræder destinationslandets importregler, kan blive tilbageholdt i tolden.
What is the half-life of IGF-1 LR3?
IGF-1 LR3 has an estimated half-life of 20–30 hours in preclinical research — dramatically longer than native IGF-1 (approximately 6–8 hours). The LR3 modification reduces IGF-binding protein (IGFBP) affinity, increasing the free (bioavailable) IGF-1 fraction in circulation and extending active duration.
How does IGF-1 LR3 differ from native IGF-1?
IGF-1 LR3 is an 83-amino-acid analog of the naturally occurring 70-amino-acid IGF-1. The LR3 modification significantly reduces binding to the six known IGF-binding proteins (IGFBPs), which normally sequester ~98% of endogenous IGF-1. This results in a substantially higher free-peptide fraction and extended half-life, making IGF-1 LR3 a preferred compound in research requiring prolonged IGF-1 receptor activation.
Can I order IGF-1 LR3 alongside other peptides?
Ja. Peptidordrer samles og sendes sammen via vores peptid-specifikke kurertjeneste. Lyofiliseret hætteglas er temperaturstabile under standard international transport. Se vores peptidkategoriside for det fulde lager og sammenligningsguiden “Bedste peptider til recovery” for stakkebetragtninger fra den offentliggjorte litteratur.
IGF-1 LR3 protocols frequently include BPC-157 and TB-500 for joint and tendon support during the IGF-driven anabolic phase; our Peptide Healing Stack (BPC-157 5 mg + TB-500 5 mg + bacteriostatisk vand) bundles both lyophilised vials with reconstitution water at $0 peptide-shipping rate.
Andre peptider til recovery- og præstationsforskning
- BPC-157 — Body Protection Compound — forskning i sener, ligament og tarmsundhed
- TB-500 — Thymosin Beta-4 fragment — forskning i blødt væv og vascular genopretning
- Ipamorelin — Selektiv ghrelin agonist — ren GH-puls uden cortisol/prolaktin
- CJC-1295 with DAC — GHRH-analog med forlænget halveringstid
- GHK-Cu — Kobberpeptid — forskning i hud og bindevævsregeneration
Yderligere læsning
📖 Lær forskningen bag dette peptid
Læs vores komplette evidensbaserede guide: IGF-1 LR3 — honest science, dosing & safety. Dækker virkningsmekanisme, publiceret forskningsdata, typiske forskningsdoseringer, rekonstitutionsprotokoller, stakkebetragtninger og sikkerheds-/kontraindikationsnoter.
📦 Hver ordre er dækket af vores Reshipment Assurance Policy — hvis din pakke ikke ankommer inden for 20 hverdage, sender vi en erstatning.
| Specifikation | Detaljer |
|---|---|
| CAS-nummer | 946870-92-4 |
| Molekylær formel | C400H625N111O120S9 |
| Molekylvægt | ~9117.4 Da |
| Sekvens | Long R3 IGF-1 (83 amino acids; N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA) |
| Form | Lyofiliseret pulver (eller som leveret) |
| Renhed | ≥99% (HPLC verificeret, COA på anmodning) |
| Opbevaring | Lyophilized: 2–8 °C (refrigerator) for working stock; −20 °C for long-term storage of unopened vials. Reconstituted: 2–8 °C, use within ~30 days. Avoid vigorous agitation; large peptides denature with shaking. Do not freeze–thaw the reconstituted solution. |
| Opløselighed | Bakteriostatisk vand (anbefales) eller sterilt vand til kortere brugsperioder |
| Til forskningsbrug | Kun til laboratorieforskningsbrug. Ikke til humant eller veterinært diagnostisk eller terapeutisk brug. |



























Anmeldelser
Der er ingen anmeldelser endnu