✓ Credit card payment restored — secure checkout via Privacy Shield

VIP (Vasoactive Intestinal Peptide) — Research Grade

✅ Synthetic 28-aa human neuropeptide (VIP/PACAP family, secretin-glucagon superfamily)
✅ VPAC1 + VPAC2 receptor agonist (Gs-coupled GPCRs) → cAMP-PKA cascade
✅ Vasodilation, smooth-muscle relaxation, Th2-polarised immune modulation
✅ Master coupling neurotransmitter of suprachiasmatic-nucleus circadian rhythm
✅ CAS 40077-57-4; MW 3,325.79; C-terminal amide

VIP (Vasoactive Intestinal Peptide) contains synthetic 28-aa human neuropeptide.

Medically reviewed by Morgan Ellis — Pharmacy Researcher · 8 years experience  · Last reviewed: May 2026

Buy more, save more Price per vial
Select a strength above to see pack pricing.
Encrypted checkout
Crypto pays 10% less
Discreet worldwide delivery
1,400+ customers · 50+ countries
BAC Water
💧 You’ll need BAC Water to reconstitute this peptide
Bacteriostatic water for injection — required to mix the lyophilised peptide powder into an injectable solution. One 10 ml vial reconstitutes multiple peptide vials.
Add BAC Water (10 ml × 10 Vials, US$50.00) →
Already have BAC Water? Skip this. Need a different pack size? View all sizes →

Quick Answer — What is VIP (Vasoactive Intestinal Peptide)?

VIP (Vasoactive Intestinal Peptide; CAS 40077-57-4, MW 3,325.79 g/mol) is a synthetic 28-amino-acid neuropeptide identical to native human VIP. Sequence: His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 (C-terminal amide). Member of the VIP/PACAP / secretin-glucagon superfamily. VIP acts at VPAC1 and VPAC2 receptors (Gs-coupled GPCRs) to produce a remarkable breadth of physiological effects: vasodilation, intestinal smooth-muscle relaxation, exocrine secretion, neurotransmitter modulation, sleep / circadian regulation, and broad anti-inflammatory / immune-modulating activity. Published research focuses on VIP’s role in Th2-polarised immune-modulation, autoimmune-disease pharmacology (RA, MS, IBD models), and neuroprotection. For laboratory research use only.

What you get with MedsBase: Lyophilized ≥99% HPLC-verified VIP · COA available on request · Discreet temperature-stable packaging · Worldwide research-supply courier · 1,400+ verified customer reviews

📦 Every order is covered by our Reshipment Assurance Policy — if your parcel does not arrive within 20 business days, we reship it.

SpecificationDetail
Compound ClassSynthetic 28-aa neuropeptide; VPAC1 / VPAC2 receptor agonist; secretin-glucagon superfamily member
CAS Number40077-57-4 (human VIP)
SequenceHis-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2; 28 aa; C-terminal amide)
Molecular Weight3,325.79 g/mol
Molecular FormulaC147H237N43O43S; MW 3326.78 g/mol (28-aa free-amide neuropeptide).
MechanismBinds VPAC1 (broad distribution: lung, GI tract, T cells, brain, liver) and VPAC2 (smooth muscle, mast cells, CNS) with similar affinity (low-nM KD). Both receptors are Gs-coupled — raises intracellular cAMP, activates PKA, drives downstream tissue-specific effects. Also has lower-affinity engagement of PAC1 receptor (the PACAP-preferred receptor).
Form / Purity / StorageLyophilized white-to-off-white powder, ≥99% HPLC. Store 2–8 °C short-term, −20 °C long-term (≥36 months). Reconstituted: 2–8 °C, use within 30 days.
Research UseFor laboratory research use only. Not on the WADA Prohibited List. Aviptadil (synthetic VIP formulation) had inhalation-route Phase III research for COVID-19 ARDS but did not gain regulatory approval.

Mechanism of Action — VPAC1 / VPAC2 Pharmacology

  • Dual VPAC1 + VPAC2 agonism — VIP binds both receptors with similar affinity. VPAC1 distribution is broad (lung, GI, T cells, hepatocytes, brain). VPAC2 is concentrated on smooth muscle, mast cells, CNS, and selected immune-cell populations.
  • cAMP-PKA cascade — Both VPAC receptors are Gs-coupled, drive adenylate cyclase, raise cAMP, and activate PKA. Downstream tissue-specific effects depend on PKA substrate availability.
  • Smooth-muscle relaxation — VPAC2-mediated cAMP rise in airway smooth muscle drives bronchodilation; in GI smooth muscle drives intestinal relaxation; in vascular smooth muscle drives vasodilation.
  • Th2-polarised immune modulation — VPAC1 activation on T cells drives Th2 polarisation, suppresses Th1 cytokine production (IFN-γ, IL-12), reduces TNF-α / IL-6 inflammatory output, increases IL-10 / TGF-β regulatory cytokines. Net effect is anti-inflammatory in autoimmune-disease models (rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, sepsis).
  • Mast-cell modulation — VIP releases histamine from mast cells at high concentrations but can also stabilise mast-cell granule release in some contexts (concentration- and tissue-dependent).
  • Neuroprotection — VPAC2 on CNS neurons drives PKA-CREB pro-survival signalling; published research in ischaemic stroke, Parkinson’s-disease, and neurodegeneration models has documented neuroprotective effects.
  • Circadian regulation — VIP is the master coupling neurotransmitter of the suprachiasmatic nucleus (SCN), synchronising individual SCN neurons into the coordinated master clock that drives circadian rhythm.

Published Research Applications

  • VPAC receptor pharmacology — canonical reference compound for VPAC1/VPAC2 research
  • Autoimmune-disease research — published anti-inflammatory effects in RA, MS, IBD, sepsis models
  • Pulmonary research — Aviptadil (synthetic VIP inhalation) studied for sarcoidosis, pulmonary fibrosis, COVID-19 ARDS
  • Vasodilation pharmacology — historical research on VIP-mediated vascular and erectile function
  • Circadian rhythm research — SCN-network coupling pharmacology
  • Th1/Th2 polarisation research — VIP is canonical Th2-polarising peptide alongside IL-4
  • Neuroprotection / neurodegeneration research — ischaemic stroke, Parkinson’s, Alzheimer’s models

For related research peptides see Oxytocin Acetate (posterior pituitary nonapeptide), Selank (Russian-developed neuropeptide), Semax (nootropic peptide), DSIP (delta sleep-inducing peptide), Thymosin Alpha-1 (immune modulator). Browse the full peptide research catalog.

Available Strengths

Vial StrengthPack Sizes
5 mg — standard research strength10 or 20 vials
10 mg — extended protocols, lower per-mg cost10 or 20 vials
💧 Need BAC water? Reconstituting any lyophilized vial requires sterile bacteriostatic water. Pair this product with our BAC Water (Bacteriostatic Water) — 30 mL multi-dose vial, 0.9% benzyl-alcohol-preserved, USP-grade.

Storage and Reconstitution

Lyophilized 2–8 °C short-term, −20 °C long-term. Reconstitute with bacteriostatic water (1.0 mL per 5/10 mg vial → 5 / 10 mg/mL). Avoid freeze-thaw. VIP is sensitive to oxidation at the Met-17 residue — protect reconstituted solutions from prolonged air exposure.

FAQ

Is VIP the same as PACAP?

No — they are related (same superfamily) but distinct peptides. PACAP-38 and PACAP-27 are alternative ligands of the same VPAC1/VPAC2 receptors (with PAC1 selectivity not shared by VIP). VIP and PACAP have ~68% sequence identity.

What dose ranges are used in research?

Rodent in-vivo protocols typically use 1–10 nmol/kg SC or IP. In-vitro work uses nanomolar concentrations. Aviptadil clinical inhalation dosing was 100 µg 3× daily in COVID-19 research.

Why is VIP plasma half-life short?

VIP is rapidly degraded by neutral endopeptidase (NEP) and other peptidases with plasma half-life of approximately 2 minutes. This makes SC / IP dosing the standard research route; inhalation delivery (Aviptadil) bypasses first-pass plasma clearance for pulmonary indications.

Why order research compounds from MedsBase: Lyophilized HPLC ≥99% peptides & compounds · COA available on request · Discreet temperature-stable packaging · Worldwide courier · Reshipment Assurance on every order · 1,400+ verified customer reviews

Other Neuropeptide / Immune Research Peptides

More options in Peptides

Ranked by recent MedsBase order volume — what other customers in this category are picking.

Strength

5 mg, 10 mg

Quantity

10 Vials, 20 Vials, 30 Vials

Recensioner

Det finns inga recensioner än

Skriv en recension
VIP (Vasoactive Intestinal Peptide) — Research Grade VIP (Vasoactive Intestinal Peptide) — Research Grade
Betyg*
0/5
* Betyg är obligatoriskt
* Svar är obligatoriskt
Din recension
* Recension är obligatorisk
Namn
* Namn är obligatoriskt
Lägg till foton eller video i din recension

Frågor & svar

Ställ en fråga
VIP (Vasoactive Intestinal Peptide) — Research Grade VIP (Vasoactive Intestinal Peptide) — Research Grade
Din fråga
* Fråga är obligatorisk
Namn
* Namn är obligatoriskt
Det finns inga frågor än