Quick Answer — What is IGF-1 LR3?
IGF-1 LR3 is a research peptide supplied as a lyophilized powder for reconstitution. It is sold for laboratory and research-use applications only and is not approved for human therapeutic use by FDA, EMA, MHRA, or other major drug regulators. The information on this page describes published preclinical and early clinical literature; it is not medical advice or dosing guidance. Read our linked research guide for the complete evidence summary.
IGF-1 LR3 Peptide
IGF-1 LR3 (Insulin-Like Growth Factor-1 Long R3) is a modified analog of insulin-like growth factor-1 designed for research involving cellular growth signaling, anabolic pathways, and metabolic regulation. This extended variant contains structural modifications that increase its stability and prolong its biological activity compared to standard IGF-1, allowing researchers to study sustained IGF-1 receptor activation in laboratory models. IGF-1 LR3 interacts with IGF-1 receptors involved in cellular proliferation, protein synthesis, and nutrient utilization. Due to its extended half-life and reduced binding to IGF-binding proteins, it provides a useful framework for examining mechanisms related to tissue growth, metabolic efficiency, and cellular repair processes. Research studies suggest IGF-1 LR3 may support pathways associated with muscle cell growth, enhanced protein synthesis, improved recovery from physical stress, and regulation of glucose metabolism. Its activity also makes it valuable for investigating regenerative signaling, cellular differentiation, and anabolic responses in controlled experimental environments.
Produktöversikt
IGF-1 LR3 is a synthetic research peptide classified as a modified insulin-like growth factor analog engineered to extend biological stability and receptor interaction duration in laboratory models. With the molecular formula C400H625N111O115S9 and molar mass of 9117.60 g/mol, IGF-1 LR3 peptide is widely studied in experimental research settings focusing on cellular growth pathways and metabolic signaling. Each vial contains 0.1 mg or 1 mg of lyophilized IGF-1 LR3 supplied in high purity lyophilized form designed for laboratory investigation. The peptide is valued for its structural modifications that reduce binding to IGF-binding proteins and prolong receptor activity in controlled research environments. Image alt-text example: “lyophilized IGF-1 LR3 peptide vial for laboratory research investigation.” IGF-1 LR3 for research maintains stability under proper storage conditions with a shelf life of approximately 36 months and is intended strictly for research and laboratory use only.
Research Applications
IGF-1 LR3 peptide is commonly utilized in laboratory investigation of cellular growth signaling and anabolic pathway activity. In vitro studies frequently examine IGF-1 receptor activation and downstream intracellular signaling mechanisms associated with protein synthesis and nutrient utilization. Pre-clinical models use IGF-1 LR3 for research to analyze cellular proliferation patterns and metabolic regulation responses. Researchers also explore tissue culture environments where growth factor signaling can be measured under controlled experimental conditions. IGF-1 LR3 supports investigations into cellular differentiation, metabolic signaling cascades, and anabolic response pathways. These applications provide valuable insight into mechanisms associated with growth signaling networks in experimental research settings.
Reconstitution and Handling
Lyophilized IGF-1 LR3 should be reconstituted using bacteriostatic water in a sterile laboratory environment. Researchers should apply strict aseptic technique when introducing solvent into the vial to preserve peptide integrity and experimental accuracy. Inject the solution slowly along the inner vial wall to prevent peptide destabilization. Avoid shaking the vial; instead, gently swirl until the lyophilized IGF-1 LR3 powder is fully dissolved. After reconstitution, store the solution at 2–8°C and maintain it in a controlled laboratory environment. Proper handling procedures help preserve the stability of IGF-1 LR3 peptide for consistent experimental outcomes.
Mechanism of Action
IGF-1 LR3 peptide interacts primarily with insulin-like growth factor receptors involved in cellular growth and metabolic signaling. In experimental research settings, this interaction stimulates intracellular pathways related to protein synthesis, nutrient uptake, and cellular proliferation markers. The structural modification of IGF-1 LR3 reduces affinity for IGF-binding proteins, allowing sustained receptor activation in laboratory models. In vitro studies indicate that this prolonged signaling may influence pathways related to anabolic cellular responses. Researchers use IGF-1 LR3 for research to explore receptor activation dynamics and downstream molecular cascades. These mechanisms provide insight into regulatory processes associated with cellular growth and metabolic adaptation.
Research Dosage Guidelines
For research reference only – not for human use. Research dosing ranges reported in published experimental literature vary depending on the model system and assay design. In vitro investigations often use IGF-1 LR3 peptide concentrations measured in nanomolar to micromolar ranges depending on cell line sensitivity. Pre-clinical experimental models may adjust concentration parameters to evaluate receptor signaling responses and metabolic activity markers. Researchers should determine optimal concentration ranges through preliminary assay validation. Lyophilized IGF-1 LR3 should be prepared and measured carefully to maintain experimental consistency.
Potential Research Benefits
- Cellular response markers related to growth factor signaling
- Tissue culture observations of anabolic pathway activation
- Stability of signaling activity in simulated metabolic environments
- Receptor interaction potential with IGF-1 signaling pathways
- Angiogenic and proliferative pathway signaling markers
Experimental Observations
Laboratory investigations involving IGF-1 LR3 peptide often observe enhanced signaling activity within IGF-1 receptor pathways in controlled experimental conditions. In vitro cell culture models demonstrate measurable changes in cellular proliferation markers and protein synthesis indicators. Researchers studying metabolic signaling frequently document changes in nutrient uptake pathways when IGF-1 LR3 is introduced to experimental systems. Pre-clinical models have also examined IGF-1 LR3 in relation to differentiation signaling and cellular development patterns. These observations contribute to understanding how sustained receptor activation influences complex cellular networks. IGF-1 LR3 for research therefore provides a reproducible framework for studying anabolic signaling pathways in experimental research settings.
Research Considerations
Researchers working with IGF-1 LR3 should ensure strict laboratory protocols are followed to maintain peptide stability and experimental validity. Environmental conditions such as temperature, solvent compatibility, and assay sensitivity can influence peptide behavior in vitro studies. Careful calibration of concentrations is recommended before initiating extended laboratory investigation. IGF-1 LR3 peptide may interact with other growth factors or signaling molecules within complex experimental systems. Documentation of handling procedures and experimental parameters is essential for reproducibility. All work involving IGF-1 LR3 must remain within approved research and laboratory use guidelines.
Safety Notice
IGF-1 LR3 peptide should be handled using standard laboratory safety practices including protective equipment and appropriate containment procedures. Researchers must ensure that the compound is stored, handled, and disposed of according to institutional laboratory safety guidelines. Direct exposure should be minimized and laboratory-grade handling tools should be used when preparing experimental solutions. This peptide is intended exclusively for scientific investigation and must not be used outside of controlled research environments. IGF-1 LR3 is not approved for human or veterinary use and should only be used in professional research facilities.
Disclaimer: This product is intended strictly for laboratory research purposes only and is not for human or veterinary use. The information provided is for educational and scientific reference and should not be interpreted as medical advice or as a recommendation for any form of administration. Researchers should follow all applicable regulations and institutional guidelines when handling this material.
Förvaringsinformation
Store lyophilized IGF-1 LR3 at −20°C for long-term storage to maintain peptide stability and structural integrity. For short-term laboratory use, the peptide may be stored at 2–8°C under controlled refrigeration conditions. Protect IGF-1 LR3 from direct light exposure to prevent degradation of the peptide structure. Avoid repeated freeze-thaw cycles as these may reduce peptide stability and affect experimental reproducibility. When stored properly, IGF-1 LR3 maintains a shelf life of approximately 36 months. Proper storage ensures reliable laboratory performance of lyophilized IGF-1 LR3 for research.
Purity & Quality
All IGF-1 LR3 vials stocked by MedsBase are supplied at 99%+ HPLC purity in lyophilized form. A certificate of analysis (COA) is available on request — message our support team after placing your order and we will forward the batch-specific COA for the vials you received.
Vanliga frågor
What is the regulatory status of IGF-1 LR3?
IGF-1 LR3 is not approved for human therapeutic use in the United States, European Union, United Kingdom, Canada, or Australia. It is sold for research-use applications only. Some peptides in this class have been used in early-phase clinical trials but no major regulator has issued a marketing authorization for the indications discussed in the popular literature.
How is IGF-1 LR3 reconstituted?
Lyophilized peptides are typically reconstituted with bacteriostatic water or sterile water for injection (BWFI / SWFI) at a concentration appropriate for the planned dose. Add the diluent slowly down the inside wall of the vial — do not inject the stream directly into the powder cake or shake vigorously, as both denature the peptide. Swirl gently until fully dissolved. Reconstituted peptides are typically stored refrigerated at 2–8°C.
How should IGF-1 LR3 be stored?
Lyophilized vials are stable for extended periods when stored at −20°C or refrigerated at 2–8°C, away from direct light. After reconstitution, most peptides are stable for 14–30 days refrigerated, depending on the buffer and the specific peptide. Always read the certificate of analysis included with the vial for the supplier’s recommended storage and stability data.
What does the published research show?
The published literature on IGF-1 LR3 is summarized in our linked research guide. We separate preclinical (rodent / cell-culture) data, where it is consistent and reproducible, from clinical-trial data, where evidence is typically thinner. We also flag where popular online claims outrun the published record.
Is IGF-1 LR3 legal to order internationally?
Research peptides occupy an ambiguous regulatory space. Importation rules vary by country and have changed in several jurisdictions over the past few years. It is the buyer’s responsibility to confirm import legality in their destination country before ordering. MedsBase ships peptides worldwide via our dedicated peptide courier; orders that contravene the destination country’s import rules may be detained at customs.
What is the half-life of IGF-1 LR3?
IGF-1 LR3 has an estimated half-life of 20–30 hours in preclinical research — dramatically longer than native IGF-1 (approximately 6–8 hours). The LR3 modification reduces IGF-binding protein (IGFBP) affinity, increasing the free (bioavailable) IGF-1 fraction in circulation and extending active duration.
How does IGF-1 LR3 differ from native IGF-1?
IGF-1 LR3 is an 83-amino-acid analog of the naturally occurring 70-amino-acid IGF-1. The LR3 modification significantly reduces binding to the six known IGF-binding proteins (IGFBPs), which normally sequester ~98% of endogenous IGF-1. This results in a substantially higher free-peptide fraction and extended half-life, making IGF-1 LR3 a preferred compound in research requiring prolonged IGF-1 receptor activation.
Can I order IGF-1 LR3 alongside other peptides?
Yes. Peptide orders are bundled and ship together via our peptide-only courier service. Lyophilized vials are temperature-stable for the duration of standard international transit. See our peptide category page for the full stocked range and the “Best Peptides for Recovery” comparison guide for stacking considerations from the published literature.
IGF-1 LR3 protocols frequently include BPC-157 and TB-500 for joint and tendon support during the IGF-driven anabolic phase; our Peptide Healing Stack (BPC-157 5 mg + TB-500 5 mg + bacteriostatic water) bundles both lyophilised vials with reconstitution water at $0 peptide-shipping rate.
Other Peptides for Recovery and Performance Research
- BPC-157 — Body Protection Compound — tendon, ligament, gut recovery research
- TB-500 — Thymosin Beta-4 fragment — soft tissue and vascular recovery research
- Ipamorelin — Selective ghrelin agonist — clean GH pulse without cortisol/prolactin
- CJC-1295 with DAC — GHRH analog with extended half-life
- GHK-Cu — Copper peptide — skin and connective tissue regeneration research
Further Reading
📖 Learn the research behind this peptide
Read our complete evidence-based guide: IGF-1 LR3 — honest science, dosing & safety. Covers mechanism of action, published study data, typical research dosing ranges, reconstitution protocols, stacking considerations, and safety/contraindication notes.
📦 Varje beställning omfattas av vår Reshipment Assurance Policy — om din försändelse inte anländer inom 20 arbetsdagar, skickar vi om den.
| Specifikation | Detalj |
|---|---|
| CAS-nummer | 946870-92-4 |
| Molekylformel | C400H625N111O120S9 |
| Molekylvikt | ~9117.4 Da |
| Sekvens | Long R3 IGF-1 (83 amino acids; N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA) |
| Form | Lyofiliserat pulver (eller som levereras) |
| Renhet | ≥99% (HPLC verified, COA on request) |
| Förvaring | Lyophilized: 2–8 °C (refrigerator) for working stock; −20 °C for long-term storage of unopened vials. Reconstituted: 2–8 °C, use within ~30 days. Avoid vigorous agitation; large peptides denature with shaking. Do not freeze–thaw the reconstituted solution. |
| Löslighet | Bakteriostatisk vatten (rekommenderas) eller sterilt vatten för kortare användningsperioder |
| Forskningsanvändning | Endast för laboratorieforskning. Ej avsedd för diagnostiskt eller terapeutiskt bruk på människor eller djur. |



























Recensioner
Det finns inga recensioner än