VIP (Vasoactive Intestinal Peptide) — Research Grade

✅ Synthetic 28-aa human neuropeptide (VIP/PACAP family, secretin-glucagon superfamily)
✅ VPAC1 + VPAC2 receptor agonist (Gs-coupled GPCRs) → cAMP-PKA cascade
✅ Vasodilation, smooth-muscle relaxation, Th2-polarised immune modulation
✅ Master coupling neurotransmitter of suprachiasmatic-nucleus circadian rhythm
✅ CAS 40077-57-4; MW 3,325.79; C-terminal amide

VIP (Vasoactive Intestinal Peptide) contains synthetic 28-aa human neuropeptide.

SKU: N/A Κατηγορία: Πεπτίδια Ετικέτα: neuropeptide, έρευνα πεπτιδίου, Th2 immune modulator, Vasoactive Intestinal Peptide, VIP, VPAC1 agonist, VPAC2 agonist

✓ Ιατρικά ελεγμένο από Morgan Ellis — Ερευνητής Φαρμακευτικής · 8 χρόνια εμπειρία · Τελευταία αναθεώρηση: Μάιος 2026

Αγοράστε περισσότερα, εξοικονομήστε περισσότερα Price per vial

Επιλέξτε μια δόση παραπάνω για να δείτε τις τιμές των συσκευασιών.

Κρυπτογραφημένη αγορά

Η πληρωμή με κρυπτονομίσματα κοστίζει 10% λιγότερο

Διακριτική παγκόσμια αποστολή

1,400+ πελάτες · 50+ χώρες

Ισχύς

5 mg
10 mg

Ποσότητα

10 Vials
20 Vials
30 Vials

Εκκαθάριση

💧 Θα χρειαστείτε Νερό BAC για την ανασύνθεση αυτού του πεπτιδίου

Βακτηριοστατικό νερό για ένεση — απαιτείται για την ανάμειξη του λυοφιλισμένου σκόνου πεπτιδίου σε διαλυτό διάλυμα για ένεση. Ένα φιαλίδιο 10 ml ανασυνθέτει πολλαπλά φιαλίδια πεπτιδίων.

Προσθήκη BAC Water (10 ml × 10 Φιαλίδια, US$50.00) →

Έχετε ήδη BAC Water; Παραλείψτε αυτό. Χρειάζεστε διαφορετικό μέγεθος συσκευασίας; Δείτε όλα τα μεγέθη →

Quick Answer — What is VIP (Vasoactive Intestinal Peptide)?

VIP (Vasoactive Intestinal Peptide; CAS 40077-57-4, MW 3,325.79 g/mol) is a synthetic 28-amino-acid neuropeptide identical to native human VIP. Sequence: His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ (C-terminal amide). Member of the VIP/PACAP / secretin-glucagon superfamily. VIP acts at VPAC1 and VPAC2 receptors (Gs-coupled GPCRs) to produce a remarkable breadth of physiological effects: vasodilation, intestinal smooth-muscle relaxation, exocrine secretion, neurotransmitter modulation, sleep / circadian regulation, and broad anti-inflammatory / immune-modulating activity. Published research focuses on VIP’s role in Th2-polarised immune-modulation, autoimmune-disease pharmacology (RA, MS, IBD models), and neuroprotection. For laboratory research use only.

Αυτό που λαμβάνετε με την MedsBase: Lyophilized ≥99% HPLC-verified VIP · COA available on request · Discreet temperature-stable packaging · Worldwide research-supply courier · 1,400+ verified κριτικές πελατών

📦 Κάθε παραγγελία καλύπτεται από την Πολιτική Εγγύησης Επαναποστολής — εάν το δέμα σας δεν φτάσει εντός 20 εργάσιμων ημερών, το επαναποστέλλουμε.

Προδιαγραφή	Λεπτομέρεια
Compound Class	Synthetic 28-aa neuropeptide; VPAC1 / VPAC2 receptor agonist; secretin-glucagon superfamily member
Αριθμός CAS	40077-57-4 (human VIP)
Ακολουθία	His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂; 28 aa; C-terminal amide)
Μοριακό Βάρος	3,325.79 g/mol
Μοριακός Τύπος	C₁₄₇H₂₃₇N₄₃O₄₃S; MW 3326.78 g/mol (28-aa free-amide neuropeptide).
Mechanism	Binds VPAC1 (broad distribution: lung, GI tract, T cells, brain, liver) and VPAC2 (smooth muscle, mast cells, CNS) with similar affinity (low-nM K_D). Both receptors are Gs-coupled — raises intracellular cAMP, activates PKA, drives downstream tissue-specific effects. Also has lower-affinity engagement of PAC1 receptor (the PACAP-preferred receptor).
Form / Purity / Storage	Lyophilized white-to-off-white powder, ≥99% HPLC. Store 2–8 °C short-term, −20 °C long-term (≥36 months). Reconstituted: 2–8 °C, use within 30 days.
Ερευνητική Χρήση	For laboratory research use only. Not on the WADA Prohibited List. Aviptadil (synthetic VIP formulation) had inhalation-route Phase III research for COVID-19 ARDS but did not gain regulatory approval.

Mechanism of Action — VPAC1 / VPAC2 Pharmacology

Dual VPAC1 + VPAC2 agonism — VIP binds both receptors with similar affinity. VPAC1 distribution is broad (lung, GI, T cells, hepatocytes, brain). VPAC2 is concentrated on smooth muscle, mast cells, CNS, and selected immune-cell populations.
cAMP-PKA cascade — Both VPAC receptors are Gs-coupled, drive adenylate cyclase, raise cAMP, and activate PKA. Downstream tissue-specific effects depend on PKA substrate availability.
Smooth-muscle relaxation — VPAC2-mediated cAMP rise in airway smooth muscle drives bronchodilation; in GI smooth muscle drives intestinal relaxation; in vascular smooth muscle drives vasodilation.
Th2-polarised immune modulation — VPAC1 activation on T cells drives Th2 polarisation, suppresses Th1 cytokine production (IFN-γ, IL-12), reduces TNF-α / IL-6 inflammatory output, increases IL-10 / TGF-β regulatory cytokines. Net effect is anti-inflammatory in autoimmune-disease models (rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, sepsis).
Mast-cell modulation — VIP releases histamine from mast cells at high concentrations but can also stabilise mast-cell granule release in some contexts (concentration- and tissue-dependent).
Neuroprotection — VPAC2 on CNS neurons drives PKA-CREB pro-survival signalling; published research in ischaemic stroke, Parkinson’s-disease, and neurodegeneration models has documented neuroprotective effects.
Circadian regulation — VIP is the master coupling neurotransmitter of the suprachiasmatic nucleus (SCN), synchronising individual SCN neurons into the coordinated master clock that drives circadian rhythm.

Published Research Applications

VPAC receptor pharmacology — canonical reference compound for VPAC1/VPAC2 research
Autoimmune-disease research — published anti-inflammatory effects in RA, MS, IBD, sepsis models
Pulmonary research — Aviptadil (synthetic VIP inhalation) studied for sarcoidosis, pulmonary fibrosis, COVID-19 ARDS
Vasodilation pharmacology — historical research on VIP-mediated vascular and erectile function
Circadian rhythm research — SCN-network coupling pharmacology
Th1/Th2 polarisation research — VIP is canonical Th2-polarising peptide alongside IL-4
Neuroprotection / neurodegeneration research — ischaemic stroke, Parkinson’s, Alzheimer’s models

For related research peptides see Οξυτοκίνη Οξικό (posterior pituitary nonapeptide), Selank (Russian-developed neuropeptide), Semax (nootropic peptide), DSIP (delta sleep-inducing peptide), Thymosin Alpha-1 (immune modulator). Browse the full peptide research catalog.

Available Strengths

Vial Strength	Pack Sizes
5 mg — standard research strength	10 or 20 vials
10 mg — extended protocols, lower per-mg cost	10 or 20 vials

💧 Need BAC water? Reconstituting any lyophilized vial requires sterile bacteriostatic water. Pair this product with our BAC Water (Bacteriostatic Water) — 30 mL multi-dose vial, 0.9% benzyl-alcohol-preserved, USP-grade.

Storage and Reconstitution

Lyophilized 2–8 °C short-term, −20 °C long-term. Reconstitute with bacteriostatic water (1.0 mL per 5/10 mg vial → 5 / 10 mg/mL). Avoid freeze-thaw. VIP is sensitive to oxidation at the Met-17 residue — protect reconstituted solutions from prolonged air exposure.

FAQ

Is VIP the same as PACAP?

No — they are related (same superfamily) but distinct peptides. PACAP-38 and PACAP-27 are alternative ligands of the same VPAC1/VPAC2 receptors (with PAC1 selectivity not shared by VIP). VIP and PACAP have ~68% sequence identity.

What dose ranges are used in research?

Rodent in-vivo protocols typically use 1–10 nmol/kg SC or IP. In-vitro work uses nanomolar concentrations. Aviptadil clinical inhalation dosing was 100 µg 3× daily in COVID-19 research.

Why is VIP plasma half-life short?

VIP is rapidly degraded by neutral endopeptidase (NEP) and other peptidases with plasma half-life of approximately 2 minutes. This makes SC / IP dosing the standard research route; inhalation delivery (Aviptadil) bypasses first-pass plasma clearance for pulmonary indications.

Why order research compounds from MedsBase: Lyophilized HPLC ≥99% peptides & compounds · COA available on request · Discreet temperature-stable packaging · Worldwide courier · Reshipment Assurance on every order · 1,400+ verified κριτικές πελατών

Other Neuropeptide / Immune Research Peptides

Οξυτοκίνη Οξικό — Posterior pituitary nonapeptide
Selank — Russian anxiolytic neuropeptide
DSIP — Delta sleep-inducing peptide
Thymosin Alpha-1 — Immune-modulating peptide (Th1 polarisation; complementary)
LL-37 (Cathelicidin) — Innate-immunity antimicrobial peptide
BAC Water (Bacteriostatic Water) — Required for reconstituting any lyophilized vial — sterile, 0.9% benzyl-alcohol-preserved diluent